SLC22A13 Antibody

Images

 
Immunohistochemistry: SLC22A13 Antibody [NBP2-32712] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC22A13 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC22A13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC22A13 Protein (NBP2-32712PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC22A13 Antibody

  • OAT10
  • OCTL1
  • OCTL3
  • ORCTL3
  • ORCTL-3
  • Organic cation transporter-like 3
  • organic cationic transporter-like 3
  • organic-cation transporter like 3
  • solute carrier family 22 (organic anion transporter), member 13
  • solute carrier family 22 member 13
  • solute carrier family 22, member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-05754
Species: Hu
NBP1-59398
Species: Hu
Applications: WB
NBP1-62660
Species: Hu
Applications: WB, IHC, IHC-P
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-30037
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, ICC
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87909
Species: Hu
Applications: IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC22A13 Antibody (NBP2-32712) (0)

There are no publications for SLC22A13 Antibody (NBP2-32712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A13 Antibody (NBP2-32712) (0)

There are no reviews for SLC22A13 Antibody (NBP2-32712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC22A13 Antibody (NBP2-32712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC22A13 Products

Bioinformatics Tool for SLC22A13 Antibody (NBP2-32712)

Discover related pathways, diseases and genes to SLC22A13 Antibody (NBP2-32712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC22A13 Antibody (NBP2-32712)

Discover more about diseases related to SLC22A13 Antibody (NBP2-32712).
 

Pathways for SLC22A13 Antibody (NBP2-32712)

View related products by pathway.

Blogs on SLC22A13

There are no specific blogs for SLC22A13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC22A13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A13