SLC20A1 Antibody [HRP]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: HRP

SLC20A1 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 257-356 of human SLC20A1 (NP_005406.3).
  
  Sequence:
  KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC20A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for SLC20A1 Antibody [HRP]

• FLJ41426
• Gibbon ape leukemia virus receptor 1
• Glvr-1
• GLVR1DKFZp686J2397
• Leukemia virus receptor 1 homolog
• Phosphate transporter 1
• PiT-1PIT1
• sodium-dependent phosphate transporter 1
• solute carrier family 20 (phosphate transporter), member 1
• Solute carrier family 20 member 1

Background

Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus (see MIM 182090). These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC20A1