SLC20A2 Antibody (4B1)

Images

 
ELISA: SLC20A2 Antibody (4B1) [H00006575-M04] - Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
4B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC20A2 Antibody (4B1) Summary

Immunogen
SLC20A2 (NP_006740.1, 243 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH
Specificity
Reacts with solute carrier family 20 (phosphate transporter), member 2.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC20A2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Publications
Read Publications using H00006575-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC20A2 Antibody (4B1)

  • Gibbon ape leukemia virus receptor 2
  • Glvr-2
  • GLVR2PIT-2
  • hPit2
  • MLVAR
  • murine leukemia virus, amphotropic, receptor for
  • Phosphate transporter 2
  • pit2
  • PiT-2
  • sodium-dependent phosphate transporter 2
  • solute carrier family 20 (phosphate transporter), member 2
  • Solute carrier family 20 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32252
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-42216
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93939
Species: Hu, Mu, Rt
Applications: WB
NBP2-46198
Species: Hu
Applications: IHC, WB
NBP1-81013
Species: Hu
Applications: IHC, IHC-P
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
NB100-65676
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24768
Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
2629-FG
Species: Mu
Applications: BA
NB600-1071
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
H00006575-M04
Species: Hu, Mu
Applications: WB, ELISA

Publications for SLC20A2 Antibody (H00006575-M04)(2)


Showing Publications 1 - 2 of 2.
Publications using H00006575-M04 Applications Species
Inden M, Iriyama M, Takagi M et al. Localization of type-III sodium-dependent phosphate transporter 2 in the mouse brain. Brain Res. 2013 Jul 30 [PMID: 23911649]
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for SLC20A2 Antibody (H00006575-M04) (0)

There are no reviews for SLC20A2 Antibody (H00006575-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC20A2 Antibody (H00006575-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC20A2 Products

Bioinformatics Tool for SLC20A2 Antibody (H00006575-M04)

Discover related pathways, diseases and genes to SLC20A2 Antibody (H00006575-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC20A2 Antibody (H00006575-M04)

Discover more about diseases related to SLC20A2 Antibody (H00006575-M04).
 

Pathways for SLC20A2 Antibody (H00006575-M04)

View related products by pathway.

PTMs for SLC20A2 Antibody (H00006575-M04)

Learn more about PTMs related to SLC20A2 Antibody (H00006575-M04).

Blogs on SLC20A2

There are no specific blogs for SLC20A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC20A2 Antibody (4B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC20A2
Entrez
Uniprot