SLC20A2 Antibody (4B1)

Images

 
ELISA: SLC20A2 Antibody (4B1) [H00006575-M04] - Detection limit for recombinant GST tagged SLC20A2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
4B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC20A2 Antibody (4B1) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SLC20A2 (NP_006740.1, 243 a.a. ~ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH
Specificity
Reacts with solute carrier family 20 (phosphate transporter), member 2.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC20A2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Publications
Read Publications using H00006575-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC20A2 Antibody (4B1)

  • Gibbon ape leukemia virus receptor 2
  • GLVR-2
  • GLVR2PIT-2
  • hPit2
  • MLVAR
  • murine leukemia virus, amphotropic, receptor for
  • Phosphate transporter 2
  • Pit2
  • PiT-2
  • sodium-dependent phosphate transporter 2
  • solute carrier family 20 (phosphate transporter), member 2
  • Solute carrier family 20 member 2

Background

Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-42216
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DY1268
Species: Hu
Applications: ELISA
NBP1-81933
Species: Hu
Applications: IHC, IHC-P
NBP2-46198
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81013
Species: Hu
Applications: IHC, IHC-P
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP2-24768
Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
2629-FG/CF
Species: Mu
Applications: BA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
H00006575-M04
Species: Hu, Mu
Applications: WB, ELISA

Publications for SLC20A2 Antibody (H00006575-M04)(2)


Showing Publications 1 - 2 of 2.
Publications using H00006575-M04 Applications Species
Inden M, Iriyama M, Takagi M et al. Localization of type-III sodium-dependent phosphate transporter 2 in the mouse brain. Brain Res. 2013-07-30 [PMID: 23911649]
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Reviews for SLC20A2 Antibody (H00006575-M04) (0)

There are no reviews for SLC20A2 Antibody (H00006575-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC20A2 Antibody (H00006575-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC20A2 Antibody (4B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC20A2
Entrez
Uniprot