Recombinant Human SLC1A4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC1A4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 140-216 of Human SLC1A4

Source: Wheat Germ

Amino Acid Sequence: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC1A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC1A4 Protein

  • Alanine/serine/cysteine/threonine transporter 1
  • ASCT1 ASCT-1
  • ASCT1
  • neutral amino acid transporter A
  • SATTglutamate/neutral amino acid transporter
  • solute carrier family 1 (glutamate/neutral amino acid transporter), member 4
  • Solute carrier family 1 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89327
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-75476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-20136
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vivo, ISH
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
AF4080
Species: Hu
Applications: WB
NBP1-74187
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, CyTOF-ready, ICFlow
NB100-93579
Species: Hu
Applications: WB, IHC-Fr, IHC-P, In vitro, B/N
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00006509-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLC1A4 Partial Recombinant Protein (H00006509-Q01) (0)

There are no publications for SLC1A4 Partial Recombinant Protein (H00006509-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC1A4 Partial Recombinant Protein (H00006509-Q01) (0)

There are no reviews for SLC1A4 Partial Recombinant Protein (H00006509-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC1A4 Partial Recombinant Protein (H00006509-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SLC1A4 Products

Bioinformatics Tool for SLC1A4 Partial Recombinant Protein (H00006509-Q01)

Discover related pathways, diseases and genes to SLC1A4 Partial Recombinant Protein (H00006509-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC1A4 Partial Recombinant Protein (H00006509-Q01)

Discover more about diseases related to SLC1A4 Partial Recombinant Protein (H00006509-Q01).
 

Pathways for SLC1A4 Partial Recombinant Protein (H00006509-Q01)

View related products by pathway.

PTMs for SLC1A4 Partial Recombinant Protein (H00006509-Q01)

Learn more about PTMs related to SLC1A4 Partial Recombinant Protein (H00006509-Q01).

Blogs on SLC1A4

There are no specific blogs for SLC1A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC1A4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A4