SLC10A4 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC10A4 Antibody [NBP1-81134] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC10A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTS
Specificity
Specificity of human SLC10A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC10A4 Protein (NBP1-81134PEP)
Publications
Read Publication using
NBP1-81134 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%). Human reactivity reported in scientific literature (PMID: 26084360).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC10A4 Antibody

  • bile acid transporter SLC10A4
  • MGC29802
  • Na(+)/bile acid cotransporter 4
  • P4
  • sodium/bile acid cotransporter 4
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 4
  • Solute carrier family 10 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008706-P01
Species: Hu
NBP2-65621
Species: Hu
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38213
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49806
Species: Hu
Applications: IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P

Publications for SLC10A4 Antibody (NBP1-81134)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC10A4 Antibody (NBP1-81134) (0)

There are no reviews for SLC10A4 Antibody (NBP1-81134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC10A4 Antibody (NBP1-81134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC10A4 Products

Bioinformatics Tool for SLC10A4 Antibody (NBP1-81134)

Discover related pathways, diseases and genes to SLC10A4 Antibody (NBP1-81134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A4 Antibody (NBP1-81134)

Discover more about diseases related to SLC10A4 Antibody (NBP1-81134).
 

Pathways for SLC10A4 Antibody (NBP1-81134)

View related products by pathway.

Blogs on SLC10A4

There are no specific blogs for SLC10A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC10A4