SKT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SKT Antibody [NBP1-84100] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: SKT Antibody [NBP1-84100] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAMEKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1217
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SKT Protein (NBP1-84100PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKT Antibody

  • DKFZP761L0424
  • KIAA1217
  • likely orthologue of Mus musculus enhancer trap locus 4
  • MGC31990
  • sickle tail protein homolog
  • SKT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-35006
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
AF5346
Species: Hu
Applications: WB
H00081876-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-79840
Species: Hu
Applications: WB (-), IP
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58342
Species: Hu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF

Publications for SKT Antibody (NBP1-84100) (0)

There are no publications for SKT Antibody (NBP1-84100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKT Antibody (NBP1-84100) (0)

There are no reviews for SKT Antibody (NBP1-84100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SKT Antibody (NBP1-84100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKT Products

SKT NBP1-84100

Bioinformatics Tool for SKT Antibody (NBP1-84100)

Discover related pathways, diseases and genes to SKT Antibody (NBP1-84100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKT Antibody (NBP1-84100)

Discover more about diseases related to SKT Antibody (NBP1-84100).
 

Pathways for SKT Antibody (NBP1-84100)

View related products by pathway.

Blogs on SKT.

Winter Protein Games
Get into the Winter Protein Games 2014! Check out the contenders competing including SKI, POLE, ICEBURG, SKT, TRAIL, WIN and BOB1. Learn more about each protein's function, gene name, molecular weight and family.View all the fun and games happening...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1217