Sirtuin 2/SIRT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane and cytosol. Antibody stainign is shown in green.
Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cerebellum shows moderate cytoplasmic positivity in oligodendrocytes.
Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in oligodendrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sirtuin 2/SIRT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
Marker
Early Oligodendrocyte Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reported in scientific literature (PMID: 24469059).
Control Peptide
Sirtuin 2/SIRT2 Protein (NBP1-87039PEP)
Publications
Read Publication using
NBP1-87039 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Human reactivity reported in scientific literature (PMID: 24469059).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sirtuin 2/SIRT2 Antibody

  • EC 3.5.1
  • EC 3.5.1.-
  • FLJ35621
  • FLJ37491
  • S.cerevisiae, homolog) 2
  • SIR2L2
  • SIRT2
  • Sirtuin 2
  • sirtuin type 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-52563
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC, IHC-P, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
DDX0010P-100
Species: Ca, Hu
Applications: Flow-CS, Flow, Func, IHC, IHC-Fr, IP, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for Sirtuin 2/SIRT2 Antibody (NBP1-87039)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Sirtuin 2/SIRT2 Antibody (NBP1-87039) (0)

There are no reviews for Sirtuin 2/SIRT2 Antibody (NBP1-87039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sirtuin 2/SIRT2 Antibody (NBP1-87039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sirtuin 2/SIRT2 Products

Bioinformatics Tool for Sirtuin 2/SIRT2 Antibody (NBP1-87039)

Discover related pathways, diseases and genes to Sirtuin 2/SIRT2 Antibody (NBP1-87039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sirtuin 2/SIRT2 Antibody (NBP1-87039)

Discover more about diseases related to Sirtuin 2/SIRT2 Antibody (NBP1-87039).
 

Pathways for Sirtuin 2/SIRT2 Antibody (NBP1-87039)

View related products by pathway.

PTMs for Sirtuin 2/SIRT2 Antibody (NBP1-87039)

Learn more about PTMs related to Sirtuin 2/SIRT2 Antibody (NBP1-87039).
 

Research Areas for Sirtuin 2/SIRT2 Antibody (NBP1-87039)

Find related products by research area.

Blogs on Sirtuin 2/SIRT2

There are no specific blogs for Sirtuin 2/SIRT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sirtuin 2/SIRT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT2