SIN3B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SIN3B Antibody [NBP2-13309] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: SIN3B Antibody [NBP2-13309] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIN3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDR DSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIN3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SIN3B Protein (NBP2-13309PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIN3B Antibody

  • Histone deacetylase complex subunit Sin3b
  • KIAA0700paired amphipathic helix protein Sin3b
  • SIN3 homolog B, transcription regulator (yeast)
  • SIN3 homolog B, transcriptional regulator (yeast)
  • SIN3 homolog B, transcriptional regulator
  • Transcriptional corepressor Sin3b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB600-1263
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6366
Species: Hu
Applications: WB, IHC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-56012
Species: Hu
Applications: ICC/IF

Publications for SIN3B Antibody (NBP2-13309) (0)

There are no publications for SIN3B Antibody (NBP2-13309).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIN3B Antibody (NBP2-13309) (0)

There are no reviews for SIN3B Antibody (NBP2-13309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SIN3B Antibody (NBP2-13309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIN3B Products

Bioinformatics Tool for SIN3B Antibody (NBP2-13309)

Discover related pathways, diseases and genes to SIN3B Antibody (NBP2-13309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIN3B Antibody (NBP2-13309)

Discover more about diseases related to SIN3B Antibody (NBP2-13309).
 

Pathways for SIN3B Antibody (NBP2-13309)

View related products by pathway.

PTMs for SIN3B Antibody (NBP2-13309)

Learn more about PTMs related to SIN3B Antibody (NBP2-13309).

Blogs on SIN3B

There are no specific blogs for SIN3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIN3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIN3B