Siglec-3/CD33 Antibody


Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody [NBP2-32709] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody [NBP2-32709] - Staining of human lung shows moderate positivity in macrophages.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody [NBP2-32709] - Staining of human lymph node shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody [NBP2-32709] - Staining of human placenta shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody [NBP2-32709] - Staining in human lung and skeletal muscle tissues. Corresponding CD33 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Siglec-3/CD33 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ
Specificity of human Siglec-3/CD33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Siglec-3/CD33 Protein (NBP2-32709PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Siglec-3/CD33 Antibody

  • CD33 antigen (gp67)
  • CD33 antigen
  • CD33 molecule
  • CD33
  • FLJ00391
  • gp67
  • myeloid cell surface antigen CD33
  • p67
  • sialic acid binding Ig-like lectin 3
  • Sialic acid-binding Ig-like lectin 3
  • Siglec3
  • Siglec-3
  • SIGLEC3gp67


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Siglec-3/CD33 Antibody (NBP2-32709) (0)

There are no publications for Siglec-3/CD33 Antibody (NBP2-32709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-3/CD33 Antibody (NBP2-32709) (0)

There are no reviews for Siglec-3/CD33 Antibody (NBP2-32709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Siglec-3/CD33 Antibody (NBP2-32709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Siglec-3/CD33 Products

Bioinformatics Tool for Siglec-3/CD33 Antibody (NBP2-32709)

Discover related pathways, diseases and genes to Siglec-3/CD33 Antibody (NBP2-32709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-3/CD33 Antibody (NBP2-32709)

Discover more about diseases related to Siglec-3/CD33 Antibody (NBP2-32709).

Pathways for Siglec-3/CD33 Antibody (NBP2-32709)

View related products by pathway.

PTMs for Siglec-3/CD33 Antibody (NBP2-32709)

Learn more about PTMs related to Siglec-3/CD33 Antibody (NBP2-32709).

Research Areas for Siglec-3/CD33 Antibody (NBP2-32709)

Find related products by research area.

Blogs on Siglec-3/CD33

There are no specific blogs for Siglec-3/CD33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Siglec-3/CD33 Antibody and receive a gift card or discount.


Gene Symbol CD33