SIAH1 Antibody (2C5)

Images

 
Western Blot: SIAH1 Antibody (2C5) [H00006477-M02] - SIAH1 monoclonal antibody (M02), clone 2C5. Analysis of SIAH1 expression in Jurkat.
Sandwich ELISA: SIAH1 Antibody (2C5) [H00006477-M02] - Detection limit for recombinant GST tagged SIAH1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SIAH1 Antibody (2C5) Summary

Immunogen
SIAH1 (NP_003022, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIAH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIAH1 Antibody (2C5)

  • E3 ubiquitin-protein ligase SIAH1
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ08065
  • hSIAH1
  • HUMSIAH
  • seven in absentia homolog 1 (Drosophila)
  • Seven in absentia homolog 1
  • Siah-1
  • SIAH1A
  • siah-1a

Background

This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson's disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB110-88113
Species: Hu, Po, Dr, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-139
Species: Hu, Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for SIAH1 Antibody (H00006477-M02) (0)

There are no publications for SIAH1 Antibody (H00006477-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAH1 Antibody (H00006477-M02) (0)

There are no reviews for SIAH1 Antibody (H00006477-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIAH1 Antibody (H00006477-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIAH1 Products

Bioinformatics Tool for SIAH1 Antibody (H00006477-M02)

Discover related pathways, diseases and genes to SIAH1 Antibody (H00006477-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIAH1 Antibody (H00006477-M02)

Discover more about diseases related to SIAH1 Antibody (H00006477-M02).
 

Pathways for SIAH1 Antibody (H00006477-M02)

View related products by pathway.

PTMs for SIAH1 Antibody (H00006477-M02)

Learn more about PTMs related to SIAH1 Antibody (H00006477-M02).
 

Research Areas for SIAH1 Antibody (H00006477-M02)

Find related products by research area.

Blogs on SIAH1

There are no specific blogs for SIAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIAH1 Antibody (2C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SIAH1
Uniprot