SI Sucrase-Isomaltase Antibody


Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-69357] - This Anti-SI antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SI Sucrase-Isomaltase Antibody Summary

Synthetic peptides corresponding to SI(sucrase-isomaltase (alpha-glucosidase)) The peptide sequence was selected from the N terminal of SI. Peptide sequence NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SI and was validated on Western blot.
Theoretical MW
209 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SI Sucrase-Isomaltase Antibody

  • EC
  • MGC131621
  • MGC131622
  • oligosaccharide alpha-1,6-glucosidase
  • sucrase-isomaltase (alpha-glucosidase)
  • sucrase-isomaltase
  • sucrase-isomaltase, intestinal


SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for SI Sucrase-Isomaltase Antibody (NBP1-69357) (0)

There are no publications for SI Sucrase-Isomaltase Antibody (NBP1-69357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SI Sucrase-Isomaltase Antibody (NBP1-69357) (0)

There are no reviews for SI Sucrase-Isomaltase Antibody (NBP1-69357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SI Sucrase-Isomaltase Antibody (NBP1-69357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SI Sucrase-Isomaltase Products

Bioinformatics Tool for SI Sucrase-Isomaltase Antibody (NBP1-69357)

Discover related pathways, diseases and genes to SI Sucrase-Isomaltase Antibody (NBP1-69357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SI Sucrase-Isomaltase Antibody (NBP1-69357)

Discover more about diseases related to SI Sucrase-Isomaltase Antibody (NBP1-69357).

Pathways for SI Sucrase-Isomaltase Antibody (NBP1-69357)

View related products by pathway.

PTMs for SI Sucrase-Isomaltase Antibody (NBP1-69357)

Learn more about PTMs related to SI Sucrase-Isomaltase Antibody (NBP1-69357).

Blogs on SI Sucrase-Isomaltase

There are no specific blogs for SI Sucrase-Isomaltase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SI Sucrase-Isomaltase Antibody and receive a gift card or discount.


Gene Symbol SI