Recombinant Human Shugoshin GST (N-Term) Protein

Recombinant Human Shugoshin Protein [H00151648-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Shugoshin GST (N-Term) Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 292 of Human SGOL1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: SGO1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 57.86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Shugoshin GST (N-Term) Protein

• FLJ14230
• hSgo1
• NY-BR-85
• Serologically defined breast cancer antigen NY-BR-85
• SGO
• Sgo1
• shugoshin 1AB protein
• shugoshin 1CD protein
• shugoshin 1EF protein
• shugoshin 1GH protein
• shugoshin 1KL protein
• shugoshin-like 1 (S. pombe)
• shugoshin-like 1

Background

SGOL1( AAH17867, 1 a.a. - 293 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

FAQs for Shugoshin Recombinant Protein (H00151648-P01). (Showing 1 - 1 of 1 FAQ).

1. What is the volume of your Recombinant Human Shugoshin Protein (H00151648-P01-2ug) ? 
   • H00151648-P01's concentration may vary from lot to lot and so does the volume we offer. Our most recent lot has a concentraton around 0.01ug/ul. As the selling size of the item is 2ug, the volume would be 200ul. 

Bioinformatics

• Gene Symbol: SGO1