Recombinant Human Shugoshin GST (N-Term) Protein Summary
Description |
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 292 of Human SGOL1 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
SGO1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
57.86 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Shugoshin GST (N-Term) Protein
Background
SGOL1( AAH17867, 1 a.a. - 293 a.a.) recombinant protein with GST.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB (-)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Species: Hu
Applications: Flow-IC, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Publications for Shugoshin Recombinant Protein (H00151648-P01) (0)
There are no publications for Shugoshin Recombinant Protein (H00151648-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Shugoshin Recombinant Protein (H00151648-P01) (0)
There are no reviews for Shugoshin Recombinant Protein (H00151648-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Shugoshin Recombinant Protein (H00151648-P01). (Showing 1 - 1 of 1 FAQ).
-
What is the volume of your Recombinant Human Shugoshin Protein (H00151648-P01-2ug) ?
- H00151648-P01's concentration may vary from lot to lot and so does the volume we offer. Our most recent lot has a concentraton around 0.01ug/ul. As the selling size of the item is 2ug, the volume would be 200ul.
Additional Shugoshin Products
Bioinformatics Tool for Shugoshin Recombinant Protein (H00151648-P01)
Discover related pathways, diseases and genes to Shugoshin Recombinant Protein (H00151648-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Shugoshin Recombinant Protein (H00151648-P01)
Discover more about diseases related to Shugoshin Recombinant Protein (H00151648-P01).
| | Pathways for Shugoshin Recombinant Protein (H00151648-P01)
View related products by pathway.
|
PTMs for Shugoshin Recombinant Protein (H00151648-P01)
Learn more about PTMs related to Shugoshin Recombinant Protein (H00151648-P01).
| | Research Areas for Shugoshin Recombinant Protein (H00151648-P01)
Find related products by research area.
|
Blogs on Shugoshin