New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human Shugoshin GST (N-Term) Protein

Images

 
Recombinant Human Shugoshin Protein [H00151648-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Shugoshin GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 292 of Human SGOL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SGO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
57.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Shugoshin GST (N-Term) Protein

  • FLJ14230
  • hSgo1
  • NY-BR-85
  • Serologically defined breast cancer antigen NY-BR-85
  • SGO
  • Sgo1
  • shugoshin 1AB protein
  • shugoshin 1CD protein
  • shugoshin 1EF protein
  • shugoshin 1GH protein
  • shugoshin 1KL protein
  • shugoshin-like 1 (S. pombe)
  • shugoshin-like 1

Background

SGOL1( AAH17867, 1 a.a. - 293 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-60454
Species: Hu
Applications: IP, WB (-)
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-87144
Species: Hu
Applications: IHC, IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-26626
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NB100-2518
Species: Hu
Applications: Flow-IC, ICC/IF, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-92579
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2359
Species: Hu
Applications: IHC, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for Shugoshin Recombinant Protein (H00151648-P01) (0)

There are no publications for Shugoshin Recombinant Protein (H00151648-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shugoshin Recombinant Protein (H00151648-P01) (0)

There are no reviews for Shugoshin Recombinant Protein (H00151648-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Shugoshin Recombinant Protein (H00151648-P01). (Showing 1 - 1 of 1 FAQ).

  1. What is the volume of your Recombinant Human Shugoshin Protein (H00151648-P01-2ug) ? 
    • H00151648-P01's concentration may vary from lot to lot and so does the volume we offer. Our most recent lot has a concentraton around 0.01ug/ul. As the selling size of the item is 2ug, the volume would be 200ul. 

Additional Shugoshin Products

Bioinformatics Tool for Shugoshin Recombinant Protein (H00151648-P01)

Discover related pathways, diseases and genes to Shugoshin Recombinant Protein (H00151648-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shugoshin Recombinant Protein (H00151648-P01)

Discover more about diseases related to Shugoshin Recombinant Protein (H00151648-P01).
 

Pathways for Shugoshin Recombinant Protein (H00151648-P01)

View related products by pathway.

PTMs for Shugoshin Recombinant Protein (H00151648-P01)

Learn more about PTMs related to Shugoshin Recombinant Protein (H00151648-P01).
 

Research Areas for Shugoshin Recombinant Protein (H00151648-P01)

Find related products by research area.

Blogs on Shugoshin

There are no specific blogs for Shugoshin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Shugoshin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGO1