SHOX Antibody - Azide and BSA Free

Western Blot: SHOX Antibody [NBP3-15753] - Western blot analysis of extracts of various cell lines, using SHOX antibody (NBP3-15753) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: SHOX Antibody [NBP3-15753] - Western blot analysis of extracts of various cell lines, using SHOX antibody (NBP3-15753) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SHOX Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SHOX (NP_000442.1). NGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHOX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SHOX Antibody - Azide and BSA Free

• GCFXX-linked
• PHOGShort stature homeobox-containing protein
• Pseudoautosomal homeobox-containing osteogenic protein
• short stature homeobox protein
• short stature homeobox
• SHOXY

Background

SHOX belongs to the paired homeobox family and is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Defects in this gene are associated with idiopathic growth retardation and in the short stature phenotype of Turner syndrome patients. This gene is highly conserved across species from mammals to fish to flies. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHOX