SHC3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SHC3 Antibody [NBP2-56058] - Staining of human cell line RT4 shows localization to nucleus & cytosol.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHC3 Antibody - BSA Free (NBP2-56058) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SHC3 Recombinant Protein Antigen (NBP2-56058PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHC3 Antibody - BSA Free

• Neuronal Shc
• NSHCDKFZp686H1544
• N-Shcsrc homology 2 domain containing transforming protein C3
• Protein Rai
• RAI
• SH2 domain protein C3
• SHC (Src homology 2 domain containing) transforming protein 3
• SHCCFLJ45325
• SHC-transforming protein 3
• SHC-transforming protein C
• src homology 2 domain-containing transforming protein C3
• Src homology 2 domain-containing-transforming protein C3

Background

Signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neuron

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHC3