SHC3 Antibody


Immunocytochemistry/ Immunofluorescence: SHC3 Antibody [NBP2-56058] - Staining of human cell line RT4 shows localization to nucleus & cytosol.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF

Order Details

SHC3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
Specificity of human SHC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SHC3 Antibody

  • Neuronal Shc
  • NSHCDKFZp686H1544
  • N-Shcsrc homology 2 domain containing transforming protein C3
  • Protein Rai
  • RAI
  • SH2 domain protein C3
  • SHC (Src homology 2 domain containing) transforming protein 3
  • SHCCFLJ45325
  • SHC-transforming protein 3
  • SHC-transforming protein C
  • src homology 2 domain-containing transforming protein C3
  • Src homology 2 domain-containing-transforming protein C3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
Species: Hu, Rt
Applications: ICC/IF

Publications for SHC3 Antibody (NBP2-56058) (0)

There are no publications for SHC3 Antibody (NBP2-56058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC3 Antibody (NBP2-56058) (0)

There are no reviews for SHC3 Antibody (NBP2-56058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHC3 Antibody (NBP2-56058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SHC3 Products

Bioinformatics Tool for SHC3 Antibody (NBP2-56058)

Discover related pathways, diseases and genes to SHC3 Antibody (NBP2-56058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC3 Antibody (NBP2-56058)

Discover more about diseases related to SHC3 Antibody (NBP2-56058).

Pathways for SHC3 Antibody (NBP2-56058)

View related products by pathway.

PTMs for SHC3 Antibody (NBP2-56058)

Learn more about PTMs related to SHC3 Antibody (NBP2-56058).

Blogs on SHC3

There are no specific blogs for SHC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SHC3 Antibody and receive a gift card or discount.


Gene Symbol SHC3