SH3TC2 Antibody

Images

 
Immunohistochemistry-Paraffin: SH3TC2 Antibody [NBP1-90624] - staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3TC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVLSFLYDKKYLPHLAVASVQQHGIQSAQGMSLPIWQVHLVLQNTTKLLGFPSPGWGEVSALACPMLRQALAACEELADRSTQRALCLILSKVYLEHRSPDGAIHYLSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3TC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3TC2 Protein (NBP1-90624PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3TC2 Antibody

  • SH3 domain and tetratricopeptide repeats 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBL1-15012
Species: Hu
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-89598
Species: Hu, Mu, Ca
Applications: IHC, IHC-Fr, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP1-90624
Species: Hu
Applications: IHC, IHC-P

Publications for SH3TC2 Antibody (NBP1-90624) (0)

There are no publications for SH3TC2 Antibody (NBP1-90624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3TC2 Antibody (NBP1-90624) (0)

There are no reviews for SH3TC2 Antibody (NBP1-90624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SH3TC2 Antibody (NBP1-90624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3TC2 Products

Bioinformatics Tool for SH3TC2 Antibody (NBP1-90624)

Discover related pathways, diseases and genes to SH3TC2 Antibody (NBP1-90624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3TC2 Antibody (NBP1-90624)

Discover more about diseases related to SH3TC2 Antibody (NBP1-90624).
 

Pathways for SH3TC2 Antibody (NBP1-90624)

View related products by pathway.

PTMs for SH3TC2 Antibody (NBP1-90624)

Learn more about PTMs related to SH3TC2 Antibody (NBP1-90624).

Blogs on SH3TC2

There are no specific blogs for SH3TC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3TC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3TC2