SH3GL3 Antibody

Images

 
Western Blot: SH3GL3 Antibody [NBP1-84419] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SH3GL3 Antibody [NBP1-84419] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3GL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3GL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SH3GL3 Protein (NBP1-84419PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3GL3 Antibody

  • CNSA3
  • EEN-B2
  • endophilin-A3
  • SH3D2C
  • SH3-domain GRB2-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02834
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7740
Species: Mu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-84419
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SH3GL3 Antibody (NBP1-84419) (0)

There are no publications for SH3GL3 Antibody (NBP1-84419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3GL3 Antibody (NBP1-84419) (0)

There are no reviews for SH3GL3 Antibody (NBP1-84419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3GL3 Antibody (NBP1-84419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3GL3 Products

Bioinformatics Tool for SH3GL3 Antibody (NBP1-84419)

Discover related pathways, diseases and genes to SH3GL3 Antibody (NBP1-84419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3GL3 Antibody (NBP1-84419)

Discover more about diseases related to SH3GL3 Antibody (NBP1-84419).
 

Pathways for SH3GL3 Antibody (NBP1-84419)

View related products by pathway.

PTMs for SH3GL3 Antibody (NBP1-84419)

Learn more about PTMs related to SH3GL3 Antibody (NBP1-84419).

Blogs on SH3GL3

There are no specific blogs for SH3GL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3GL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3GL3