SH3BP1 Antibody

Images

 
Western Blot: SH3BP1 Antibody [NBP2-88259] - WB Suggested Anti-SH3BP1 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellSH3BP1 is supported by BioGPS gene expression data to be expressed in 721_B

Product Details

Summary
Reactivity Hu, Rt, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3BP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SH3BP1. Peptide sequence: QPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Canine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BP1 Antibody

  • 3BP-1
  • ARHGAP43
  • SH3 domain binding protein 1
  • SH3 domain-binding protein 1
  • SH3-domain binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-19098
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-49695
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-62489
Species: Hu, Mu, Dr
Applications: WB
NBP2-49172
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-18922
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IP
H00008826-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-94863
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88259
Species: Hu, Rt, Ca
Applications: WB

Publications for SH3BP1 Antibody (NBP2-88259) (0)

There are no publications for SH3BP1 Antibody (NBP2-88259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP1 Antibody (NBP2-88259) (0)

There are no reviews for SH3BP1 Antibody (NBP2-88259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BP1 Antibody (NBP2-88259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH3BP1 Products

Bioinformatics Tool for SH3BP1 Antibody (NBP2-88259)

Discover related pathways, diseases and genes to SH3BP1 Antibody (NBP2-88259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP1 Antibody (NBP2-88259)

Discover more about diseases related to SH3BP1 Antibody (NBP2-88259).
 

Pathways for SH3BP1 Antibody (NBP2-88259)

View related products by pathway.

Blogs on SH3BP1

There are no specific blogs for SH3BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP1