SH3BP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SH3BP1 Antibody [NBP1-88827] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SH3BP1 Antibody [NBP1-88827] - Staining in human spleen and kidney tissues using anti-SH3BP1 antibody. Corresponding SH3BP1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SH3BP1 Antibody [NBP1-88827] - Staining of human colon shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SH3BP1 Antibody [NBP1-88827] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SH3BP1 Antibody [NBP1-88827] - Staining of human spleen shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SH3BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGLFSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SH3BP1 Protein (NBP1-88827PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BP1 Antibody

  • 3BP-1
  • ARHGAP43
  • SH3 domain binding protein 1
  • SH3 domain-binding protein 1
  • SH3-domain binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF7548
Species: Hu
Applications: IHC
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NBP2-49229
Species: Hu
Applications: ICC/IF, IHC, IHC-P
1250-S3
Species: Hu
Applications: BA, BA
H00010146-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP2-94863
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88827
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SH3BP1 Antibody (NBP1-88827) (0)

There are no publications for SH3BP1 Antibody (NBP1-88827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP1 Antibody (NBP1-88827) (0)

There are no reviews for SH3BP1 Antibody (NBP1-88827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SH3BP1 Antibody (NBP1-88827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3BP1 Products

Bioinformatics Tool for SH3BP1 Antibody (NBP1-88827)

Discover related pathways, diseases and genes to SH3BP1 Antibody (NBP1-88827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP1 Antibody (NBP1-88827)

Discover more about diseases related to SH3BP1 Antibody (NBP1-88827).
 

Pathways for SH3BP1 Antibody (NBP1-88827)

View related products by pathway.

Blogs on SH3BP1

There are no specific blogs for SH3BP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP1