SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.Lane 1: SLC5A2 transfected lysate(72.9 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC5A2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SGLT2/SLC5A2 Antibody (3G8) - Azide and BSA Free

• Low affinity sodium-glucose cotransporter
• Na(+)/glucose cotransporter 2
• SGLT2
• SGLT2sodium/glucose cotransporter 2
• SLC5A2
• solute carrier family 5 (sodium/glucose cotransporter), member 2
• solute carrier family 5 (sodium/glucose transporter), member 2
• Solute carrier family 5 member 2

Background

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SGLT2/SLC5A2 Antibody (H00006524-M01)(1)

Publication using H00006524-M01

• Lu YT, Ma XL, Xu YH et al. A Fluorescent Glucose Transport Assay for Screening SGLT2 Inhibitors in Endogenous SGLT2-Expressing HK-2 Cells. Nat Prod Bioprospect 2018-11-01 [PMID: 30387082]

Bioinformatics

• Gene Symbol: SLC5A2
• Entrez:
  • 6524(Human)