SGLT2/SLC5A2 Antibody (3G8)

Images

 
Western Blot: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody (M01), clone 3G8.Lane 1: SLC5A2 transfected lysate(72.9 KDa).Lane 2: ...read more
Sandwich ELISA: SGLT2/SLC5A2 Antibody (3G8) [H00006524-M01] - Detection limit for recombinant GST tagged SLC5A2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SGLT2/SLC5A2 Antibody (3G8) Summary

Immunogen
SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC5A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Control
SGLT2/SLC5A2 Knockout HeLa Cell Lysate
Publications
Read Publication using H00006524-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SGLT2/SLC5A2 Antibody (3G8)

  • Low affinity sodium-glucose cotransporter
  • Na(+)/glucose cotransporter 2
  • SGLT2
  • SGLT2sodium/glucose cotransporter 2
  • SLC5A2
  • solute carrier family 5 (sodium/glucose cotransporter), member 2
  • solute carrier family 5 (sodium/glucose transporter), member 2
  • Solute carrier family 5 member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20338
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000265-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
NBP1-62481
Species: Hu
Applications: WB
7270-IL/CF
Species: Hu
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006524-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for SGLT2/SLC5A2 Antibody (H00006524-M01)(1)

Reviews for SGLT2/SLC5A2 Antibody (H00006524-M01) (0)

There are no reviews for SGLT2/SLC5A2 Antibody (H00006524-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGLT2/SLC5A2 Antibody (H00006524-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SGLT2/SLC5A2 Products

Bioinformatics Tool for SGLT2/SLC5A2 Antibody (H00006524-M01)

Discover related pathways, diseases and genes to SGLT2/SLC5A2 Antibody (H00006524-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGLT2/SLC5A2 Antibody (H00006524-M01)

Discover more about diseases related to SGLT2/SLC5A2 Antibody (H00006524-M01).
 

Pathways for SGLT2/SLC5A2 Antibody (H00006524-M01)

View related products by pathway.

PTMs for SGLT2/SLC5A2 Antibody (H00006524-M01)

Learn more about PTMs related to SGLT2/SLC5A2 Antibody (H00006524-M01).
 

Research Areas for SGLT2/SLC5A2 Antibody (H00006524-M01)

Find related products by research area.

Blogs on SGLT2/SLC5A2

There are no specific blogs for SGLT2/SLC5A2, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGLT2/SLC5A2 Antibody (3G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC5A2
Entrez