SFXN4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SFXN4 Antibody [NBP1-86428] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: SFXN4 Antibody [NBP1-86428] - Staining of human heart muscle shows strong positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SFXN4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFXN4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SFXN4 Protein (NBP1-86428PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SFXN4 Antibody - BSA Free

• BCRM1
• Breast cancer resistance marker 1
• sideroflexin 4
• sideroflexin-4

Background

Potential iron transporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFXN4