SFXN4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SFXN4 Antibody [NBP1-86428] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: SFXN4 Antibody [NBP1-86428] - Staining of human heart muscle shows strong positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFXN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFXN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFXN4 Protein (NBP1-86428PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFXN4 Antibody

  • BCRM1
  • Breast cancer resistance marker 1
  • sideroflexin 4
  • sideroflexin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-83708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for SFXN4 Antibody (NBP1-86428) (0)

There are no publications for SFXN4 Antibody (NBP1-86428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFXN4 Antibody (NBP1-86428) (0)

There are no reviews for SFXN4 Antibody (NBP1-86428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SFXN4 Antibody (NBP1-86428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFXN4 Products

Bioinformatics Tool for SFXN4 Antibody (NBP1-86428)

Discover related pathways, diseases and genes to SFXN4 Antibody (NBP1-86428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFXN4 Antibody (NBP1-86428)

Discover more about diseases related to SFXN4 Antibody (NBP1-86428).
 

Pathways for SFXN4 Antibody (NBP1-86428)

View related products by pathway.

Blogs on SFXN4

There are no specific blogs for SFXN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFXN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFXN4