SF3A1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3A1. Source: E. coli
Amino Acid Sequence: TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SF3A1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87214. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SF3A1 Recombinant Protein Antigen
Background
SF3A1 encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Publications for SF3A1 Protein (NBP1-87214PEP) (0)
There are no publications for SF3A1 Protein (NBP1-87214PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SF3A1 Protein (NBP1-87214PEP) (0)
There are no reviews for SF3A1 Protein (NBP1-87214PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SF3A1 Protein (NBP1-87214PEP) (0)
Additional SF3A1 Products
Blogs on SF3A1