SF3A1 Recombinant Protein Antigen

Images

 
There are currently no images for SF3A1 Protein (NBP1-87214PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF3A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3A1.

Source: E. coli

Amino Acid Sequence: TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87214.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF3A1 Recombinant Protein Antigen

  • pre-mRNA processing 21
  • pre-mRNA splicing factor SF3a (120 kDa subunit)
  • Prp21
  • PRPF21
  • SAP 114
  • SAP114splicing factor 3a, subunit 1, 120kD
  • SF3a120
  • spliceosome associated protein 114
  • Spliceosome-associated protein 114
  • splicing factor 3 subunit 1
  • splicing factor 3A subunit 1
  • splicing factor 3a, subunit 1, 120kDa

Background

SF3A1 encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94076
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47281
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-64792
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-55245
Species: Hu
Applications: IHC,  IHC-P, IP, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
NB500-317
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, RIA, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03747
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-57490
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33280
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00007071-M15
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-87677
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SF3A1 Protein (NBP1-87214PEP) (0)

There are no publications for SF3A1 Protein (NBP1-87214PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3A1 Protein (NBP1-87214PEP) (0)

There are no reviews for SF3A1 Protein (NBP1-87214PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF3A1 Protein (NBP1-87214PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF3A1 Products

Blogs on SF3A1

There are no specific blogs for SF3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF3A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A1