SerpinB9 Antibody (1F5)

Images

 
Immunohistochemistry-Paraffin: SerpinB9 Antibody (1F5) [H00005272-M06] - Analysis of monoclonal antibody to SERPINB9 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml
Sandwich ELISA: SerpinB9 Antibody (1F5) [H00005272-M06] - Detection limit for recombinant GST tagged SERPINB9 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
1F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SerpinB9 Antibody (1F5) Summary

Immunogen
SERPINB9 (NP_004146, 279 a.a. - 375 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
Specificity
SERPINB9 - serpin peptidase inhibitor, clade B (ovalbumin), member 9 (1F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SERPINB9
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SerpinB9 Antibody (1F5)

  • CAP-3
  • CAP3PI-9
  • Cytoplasmic antiproteinase 3
  • Peptidase inhibitor 9
  • PI9protease inhibitor 9 (ovalbumin type)
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9
  • serpin B9
  • serpin peptidase inhibitor, clade B (ovalbumin), member 9
  • serpin peptidase inhibitor, clade B, member 9

Background

PI9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis (Sprecher et al., 1995 [PubMed 8530382]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
MAB4158
Species: Hu
Applications: IHC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
126-FL/CF
Species: Hu
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-30572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO

Publications for SerpinB9 Antibody (H00005272-M06) (0)

There are no publications for SerpinB9 Antibody (H00005272-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SerpinB9 Antibody (H00005272-M06) (0)

There are no reviews for SerpinB9 Antibody (H00005272-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SerpinB9 Antibody (H00005272-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SerpinB9 Products

Bioinformatics Tool for SerpinB9 Antibody (H00005272-M06)

Discover related pathways, diseases and genes to SerpinB9 Antibody (H00005272-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SerpinB9 Antibody (H00005272-M06)

Discover more about diseases related to SerpinB9 Antibody (H00005272-M06).
 

Pathways for SerpinB9 Antibody (H00005272-M06)

View related products by pathway.

PTMs for SerpinB9 Antibody (H00005272-M06)

Learn more about PTMs related to SerpinB9 Antibody (H00005272-M06).
 

Research Areas for SerpinB9 Antibody (H00005272-M06)

Find related products by research area.

Blogs on SerpinB9

There are no specific blogs for SerpinB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SerpinB9 Antibody (1F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB9
Entrez
Uniprot