SerpinB7 Antibody

Images

 
Immunohistochemistry: SerpinB7 Antibody [NBP1-82782] - Immunohistochemical staining of human skin shows moderate cytoplasmic and nuclear positivity in subsets of keratinocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SerpinB7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYIEVTEEGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SerpinB7 Protein (NBP1-82782PEP)
Publications
Read Publication using NBP1-82782.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24207119)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SerpinB7 Antibody

  • DKFZp686D06190
  • Megsin
  • MEGSINclade B (ovalbumin), member 7
  • mesangium predominant gene, megsin
  • MGC120014
  • MGC120015
  • serpin B7
  • serpin peptidase inhibitor, clade B (ovalbumin), member 7
  • TP55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1555
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-87780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SerpinB7 Antibody (NBP1-82782)(1)

Reviews for SerpinB7 Antibody (NBP1-82782) (0)

There are no reviews for SerpinB7 Antibody (NBP1-82782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SerpinB7 Antibody (NBP1-82782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SerpinB7 Products

Bioinformatics Tool for SerpinB7 Antibody (NBP1-82782)

Discover related pathways, diseases and genes to SerpinB7 Antibody (NBP1-82782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SerpinB7 Antibody (NBP1-82782)

Discover more about diseases related to SerpinB7 Antibody (NBP1-82782).
 

Pathways for SerpinB7 Antibody (NBP1-82782)

View related products by pathway.

Blogs on SerpinB7

There are no specific blogs for SerpinB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SerpinB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB7