Serpin D1/Heparin Cofactor II Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human cell line Hep G2 shows localization to vesicles.

Immunohistochemistry-Paraffin: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human colon shows distinctly stained plasma.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Serpin D1/Heparin Cofactor II Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPIND1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Serpin D1/Heparin Cofactor II Antibody - BSA Free

• HC2
• HC2LS2
• HCF2
• HCF2clade D (heparin cofactor), member 1
• HC-II
• Heparin Cofactor II
• HLS2HCII
• leuserpin 2
• LS2
• Protease inhibitor leuserpin-2
• Serpin D1
• serpin peptidase inhibitor, clade D (heparin cofactor), member 1

Background

The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns. This protein shares homology with antithrombin III and other members of the alpha 1-antitrypsin superfamily. Mutations in this gene are associated with heparin cofactor II deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPIND1
• Uniprot:
  • P05546()