Serpin A4/Kallistatin Antibody - BSA Free

Staining of human cell line Hep-G2 shows localization to vesicles.

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10Lane 2: RT-4Lane 3: U-251MGLane 4: Human PlasmaLane 5: LiverLane 6: Tonsil

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Serpin A4/Kallistatin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Serpin A4/Kallistatin Antibody - BSA Free (NBP3-25131) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Serpin A4/Kallistatin using the following amino acid sequence: HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERPINA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Serpin A4/Kallistatin Antibody - BSA Free

• antitrypsin), member 4
• KAL
• Kallistatin
• KLST
• KSTKallikrein inhibitor
• member 4
• PI-4
• PI4Peptidase inhibitor 4
• protease inhibitor 4 (kallistatin)
• serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
• Serpin A4
• serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)

Background

Kallistatin inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINA4