SERCA2 ATPase Antibody - BSA Free

Immunohistochemistry: SERCA2 ATPase Antibody [NBP3-35064] - Immunohistochemistry analysis of paraffin-embedded Rat heart using SERCA2 ATPase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: SERCA2 ATPase Antibody [NBP3-35064] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using SERCA2 ATPase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: SERCA2 ATPase Antibody [NBP3-35064] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using SERCA2 ATPase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: SERCA2 ATPase Antibody [NBP3-35064] - Western blot analysis of lysates from Mouse heart, using SERCA2 ATPase Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SERCA2 ATPase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SERCA2 ATPase Antibody - BSA Free (NBP3-35064) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 111-253 of human SERCA2 ATPase (NP_733765.1).
  
  Sequence:
  NAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 115 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SERCA2 ATPase Antibody - BSA Free

• ATP2A2
• ATP2B
• ATP2BFLJ20293
• ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2
• ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• Calcium pump 2
• Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform
• cardiac Ca2+ ATPase
• DAR
• DD
• EC 3.6.3
• EC 3.6.3.8
• Endoplasmic reticulum class 1/2 Ca(2+) ATPase
• FLJ38063
• MGC45367
• sarcoplasmic/endoplasmic reticulum calcium ATPase 2
• SERCA2 ATPase
• SERCA2
• SERCA2DKFZp686P0211
• SR Ca(2+)-ATPase 2

Background

Sarcoplasmic/endoplasmic reticulum Calcium-ATPase 2 (SERCA2) is a magnesium-dependent pump that catalyzes the hydrolysis of ATP and translocates calcium from the cytosol to the sarcoplasmic reticulum lumen. There are 2 SERCA2 isoforms that differ in the 3' UTR. The SERCA2A isoform is highly expressed in heart and slow twitch skeletal muscle and is important to the regulation of the contraction and relaxation cycle, while the SERCA2B isoform is expressed in smooth muscle and adult epidermis. SERCA2 is also known as ATP2A2, ATP2B, DAR, DD, and MGC45367.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP2A2