Separase Recombinant Protein Antigen

Images

 
There are currently no images for Separase Recombinant Protein Antigen (NBP3-17190PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Separase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Separase

Source: E. coli

Amino Acid Sequence: TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ESPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17190.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Separase Recombinant Protein Antigen

  • Caspase-like protein ESPL1
  • EC 3.4.22.49
  • ESP1extra spindle poles like 1
  • extra spindle pole bodies homolog 1 (S. cerevisiae)
  • extra spindle poles like 1 (S. cerevisiae)
  • Extra spindle poles-like 1 protein
  • FLJ46492
  • KIAA0165separin
  • Separase

Background

Separase is a cysteine protease that is essential for mitotic progression by separating sister chromatids. Each cell must receive one chromatid of every chromosome during mitosis. Cohesin plays an important role in cohering sister chromatids during the prophase through anaphase stages of mitosis, making certain that genomic information is replicated accurately. As the cellular division process continues, separase destroys cohesin by means of cleavage, allowing the chromatids to separate and divide with the cell. Separase activity is highly regulated. It not only cleaves cohesin at the onset of anaphase, but also cleaves itself, promoting downregulation of separase after anaphase. Should a human cell become an aneuploid (one too many or too few chromatids), the embryo most likely will not survive. Should the embryo survive, it will most likely develop severe birth defects or later develop malignant cancers. Separase antibodies can be used as a specific marker for centrosomes of mitotic cells. The staining of separase in centrosomes can be detected from prophase of mitosis up until anaphase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20287
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-59828
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-16012
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85720
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-33867
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13955
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-82758
Species: Hu
Applications: IHC,  IHC-P, WB
AF1106
Species: Hu
Applications: IP, WB

Publications for Separase Recombinant Protein Antigen (NBP3-17190PEP) (0)

There are no publications for Separase Recombinant Protein Antigen (NBP3-17190PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Separase Recombinant Protein Antigen (NBP3-17190PEP) (0)

There are no reviews for Separase Recombinant Protein Antigen (NBP3-17190PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Separase Recombinant Protein Antigen (NBP3-17190PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Separase Products

Research Areas for Separase Recombinant Protein Antigen (NBP3-17190PEP)

Find related products by research area.

Blogs on Separase

There are no specific blogs for Separase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Separase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ESPL1