SENP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SENP2 Antibody [NBP1-88920] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SENP2 Antibody [NBP1-88920] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SENP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SENP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SENP2 Protein (NBP1-88920PEP)
Publications
Read Publication using
NBP1-88920 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%). Human reactivity reported in scientific literature (PMID: 23908357).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SENP2 Antibody

  • AXAM2
  • AXAM2Axam2
  • DKFZp762A2316
  • EC 3.4.22
  • EC 3.4.22.68
  • KIAA1331sentrin-specific protease 2
  • SENP2
  • Sentrin/SUMO-specific protease SENP2
  • SMT3IP2
  • SMT3IP2EC 3.4.22.-
  • SMT3-specific isopeptidase 2
  • SUMO1/sentrin/SMT3 specific peptidase 2
  • SUMO1/sentrin/SMT3 specific protease 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77160
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56412
Species: Hu, Mu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88920
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SENP2 Antibody (NBP1-88920)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SENP2 Antibody (NBP1-88920) (0)

There are no reviews for SENP2 Antibody (NBP1-88920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SENP2 Antibody (NBP1-88920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SENP2 Products

Bioinformatics Tool for SENP2 Antibody (NBP1-88920)

Discover related pathways, diseases and genes to SENP2 Antibody (NBP1-88920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP2 Antibody (NBP1-88920)

Discover more about diseases related to SENP2 Antibody (NBP1-88920).
 

Pathways for SENP2 Antibody (NBP1-88920)

View related products by pathway.

PTMs for SENP2 Antibody (NBP1-88920)

Learn more about PTMs related to SENP2 Antibody (NBP1-88920).

Blogs on SENP2

There are no specific blogs for SENP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SENP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP2
Entrez