SENP2 Antibody - BSA Free

Western Blot: SENP2 Antibody [NBP1-88919] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.

Immunohistochemistry-Paraffin: SENP2 Antibody [NBP1-88919] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SENP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SENP2 Antibody - BSA Free (NBP1-88919) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SENP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SENP2 Protein (NBP1-88919PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SENP2 Antibody - BSA Free

• AXAM2
• AXAM2Axam2
• DKFZp762A2316
• EC 3.4.22
• EC 3.4.22.68
• KIAA1331sentrin-specific protease 2
• SENP2
• Sentrin/SUMO-specific protease SENP2
• SMT3IP2
• SMT3IP2EC 3.4.22.-
• SMT3-specific isopeptidase 2
• SUMO1/sentrin/SMT3 specific peptidase 2
• SUMO1/sentrin/SMT3 specific protease 2

Background

Covalent attachment of one protein to another is one of the more prominent posttranslational modifications in respect to size and ubiquity. Ubiquitin is the most familiar of the protein modifiers and its activation and transfer to target proteins has been studied extensively. Recently, a new group of ubiquitin-like proteins has been receiving a lot of attention. SUMO, or Sentrin, is one of the most intriguing. SUMO has been implicated in the stabilization of target proteins and/or their localization to sub-cellular complexes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SENP2