Semaphorin 6D Antibody


Western Blot: SEMA6D Antibody [NBP1-69274] - This Anti-SEMA6D antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Semaphorin 6D Antibody Summary

Synthetic peptides corresponding to SEMA6D(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D) The peptide sequence was selected from the N terminal of SEMA6D. Peptide sequence KLYSATVADFLASDAVIYRSMGDGSALRTIKYD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SEMA6D and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Semaphorin 6D Antibody

  • KIAA1479FLJ11598
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
  • Sema6D
  • Semaphorin 6D
  • semaphorin-6D


Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Species: Hu
Applications: WB

Publications for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no publications for Semaphorin 6D Antibody (NBP1-69274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no reviews for Semaphorin 6D Antibody (NBP1-69274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Semaphorin 6D Antibody (NBP1-69274)

Discover related pathways, diseases and genes to Semaphorin 6D Antibody (NBP1-69274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 6D Antibody (NBP1-69274)

Discover more about diseases related to Semaphorin 6D Antibody (NBP1-69274).

Pathways for Semaphorin 6D Antibody (NBP1-69274)

View related products by pathway.

PTMs for Semaphorin 6D Antibody (NBP1-69274)

Learn more about PTMs related to Semaphorin 6D Antibody (NBP1-69274).

Blogs on Semaphorin 6D

There are no specific blogs for Semaphorin 6D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Semaphorin 6D Antibody and receive a gift card or discount.


Gene Symbol SEMA6D