We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Semaphorin 6D Antibody - BSA Free

Images

 
Western Blot: SEMA6D Antibody [NBP1-69274] - This Anti-SEMA6D antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related Semaphorin 6D Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69274
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Semaphorin 6D Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SEMA6D(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D) The peptide sequence was selected from the N terminal of SEMA6D. Peptide sequence KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA6D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Semaphorin 6D Antibody - BSA Free

  • KIAA1479FLJ11598
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
  • Sema6D
  • Semaphorin 6D
  • semaphorin-6D

Background

Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
AF2108
Species: Mu
Applications: IHC, WB
7067-S6
Species: Mu
Applications: BA
NBP1-85313
Species: Hu
Applications: IHC,  IHC-P
AF1615
Species: Mu
Applications: IHC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
DY884B
Species: Hu
Applications: ELISA
AF1729
Species: Mu
Applications: ELISA, ICC, KO, WB
1250-S3
Species: Hu
Applications: BA, BA
NBP1-92476
Species: Hu
Applications: IHC,  IHC-P, WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
462-TEC
Species: Mu
Applications: BA

Publications for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no publications for Semaphorin 6D Antibody (NBP1-69274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no reviews for Semaphorin 6D Antibody (NBP1-69274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 6D Antibody (NBP1-69274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 6D Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA6D
Uniprot