SEC31A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SEC31A Antibody [NBP1-89301] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC31A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC31A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEC31A Protein (NBP1-89301PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC31A Antibody

  • ABP125ABP130KIAA0905Web1-like protein
  • DKFZp686N07171
  • HSPC334
  • MGC90305
  • protein transport protein Sec31A
  • protein-transport protein SEC31
  • SEC31 homolog A (S. cerevisiae)
  • SEC31L1
  • SEC31-like 1 (S. cerevisiae)
  • SEC31-like 1
  • SEC31-like protein 1
  • SEC31-related protein A
  • yeast Sec31p homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB90551
Species: Hu, Mu, Rt
Applications: WB
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
NBP1-85106
Species: Hu
Applications: IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52866
Species: Hu, Mu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB

Publications for SEC31A Antibody (NBP1-89301) (0)

There are no publications for SEC31A Antibody (NBP1-89301).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC31A Antibody (NBP1-89301) (0)

There are no reviews for SEC31A Antibody (NBP1-89301). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SEC31A Antibody (NBP1-89301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEC31A Products

Bioinformatics Tool for SEC31A Antibody (NBP1-89301)

Discover related pathways, diseases and genes to SEC31A Antibody (NBP1-89301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC31A Antibody (NBP1-89301)

Discover more about diseases related to SEC31A Antibody (NBP1-89301).
 

Pathways for SEC31A Antibody (NBP1-89301)

View related products by pathway.

PTMs for SEC31A Antibody (NBP1-89301)

Learn more about PTMs related to SEC31A Antibody (NBP1-89301).

Blogs on SEC31A

There are no specific blogs for SEC31A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC31A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC31A