SEC31A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SEC31A Antibody [NBP1-89301] - Staining of human cell line U-251 MG shows localization to cytosol & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human cerebral cortex shows positivity in neurons.

Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human endometrium shows positivity in glandular cells.

Immunohistochemistry-Paraffin: SEC31A Antibody [NBP1-89301] - Staining of human liver shows positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SEC31A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SEC31A Antibody - BSA Free (NBP1-89301) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEC31A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SEC31A Protein (NBP1-89301PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SEC31A Antibody - BSA Free

• ABP125ABP130KIAA0905Web1-like protein
• DKFZp686N07171
• HSPC334
• MGC90305
• protein transport protein Sec31A
• protein-transport protein SEC31
• SEC31 homolog A (S. cerevisiae)
• SEC31L1
• SEC31-like 1 (S. cerevisiae)
• SEC31-like 1
• SEC31-like protein 1
• SEC31-related protein A
• yeast Sec31p homolog

Background

Sec31A is similar to yeast Sec31 protein. Yeast Sec31 protein is known to be a component of the COPII protein complex which is responsible for vesicle budding from endoplasmic reticulum (ER). This protein was found to colocalize with SEC13, one of the other components of COPII, in the subcellular structures corresponding to the vesicle transport function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEC31A