SEC24A Antibody (4D9) - Azide and BSA Free

Western Blot: SEC24A Antibody (4D9) [H00010802-M01] - The effects of ouabain and low temperature on ER-related chaperones. CFBE/F508del-CFTR cells were treated with 0.1 uM ouabain or 29C (Low-Temp.) for 6, 24, or 48 h, then the cell lysates were analyzed by immunoblotting using the individual antibodies. The bar graph shows quantification of the band intensities for blots expressed as fold change vs. Time 0 h control. Values in the experiments described are presented as means +/- SD (n = 3). Means were tested for statistical significance using a Student's t-test (*P < 0.05). Image collected and cropped by CiteAb from the following publication (//journal.frontiersin.org/article/10.3389/fphar.2012.00176/abstract), licensed under a CC-BY license.

Sandwich ELISA: SEC24A Antibody (4D9) [H00010802-M01] - Detection limit for recombinant GST tagged SEC24A is 0.1 ng/ml as a capture antibody.

Western Blot: SEC24A Antibody (4D9) [H00010802-M01] - The effects of ouabain & low temperature on ER-related chaperones. (A) Left panel: Venn diagram of the intersection between ouabain & low temperature 24 h signatures according to a FDR ≤ 0.05. The numbers indicate distinct genes. The probability *P = 0.0001 was calculated using a hyper-geometric random variable. Right panel: Gene Ontology (GO) cellular processes pie chart of 3530 genes in common between ouabain & low temperature 24 h treatments. (B) The total RNA previously extracted for the microarray analysis was tested by real-time PCR using the individual primers for the gene expressions of HSPA8, HSPA1L, HSPA5, SEC24A, & CANX. Data are presented by the fold change of gene expression vs. DMSO control with mean ± SEM of n = 3 (*P < 0.05) (C) CFBE/F508del-CFTR cells were treated with 0.1 μM ouabain or 29°C (Low-Temp.) for 6, 24, or 48 h, then the cell lysates were analyzed by immunoblotting using the individual antibodies. The bar graph shows quantification of the band intensities for blots expressed as fold change vs. Time 0 h control. Values in the experiments described are presented as means ± SD (n = 3). Means were tested for statistical significance using a Student’s t-test (*P < 0.05). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/23060796), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SEC24A Antibody (4D9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SEC24A Antibody (4D9) - Azide and BSA Free (H00010802-M01) is a monoclonal antibody validated for use in WB and ELISA. Anti-SEC24A Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SEC24A (XP_094581.5, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL
• Specificity: This product is specific for Human SEC24A monoclonal antibody (M01), clone 4D9 [Gene ID: 10802].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SEC24A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant SEC24A.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEC24A Antibody (4D9) - Azide and BSA Free

• member A
• protein transport protein Sec24A
• SEC24 family, member A (S. cerevisiae)
• SEC24-related protein A

Background

In yeast, the Sec23-Sec24 complex is a component of coat protein II (COPII; see MIM 601924)-coated vesicles that mediate protein transport from the endoplasmic reticulum. SEC24A is 1 of several mammalian proteins that show structural and functional homology to yeast Sec24.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SEC24A Antibody (H00010802-M01)(2)

Publications using H00010802-M01

• Deng S, Shen Y, Gu H et al. The role of the C-terminal domain of PCSK9 and SEC24 isoforms in PCSK9 secretion. Biochim Biophys Acta Mol Cell Biol Lipids. 2020-02-11 [PMID: 32058034]
• Zhang D, Ciciriello F, Anjos SM et al. Ouabain Mimics Low Temperature Rescue of F508del-CFTR in Cystic Fibrosis Epithelial Cells Front Pharmacol 2012-01-01 [PMID: 23060796] (WB, Human)

Bioinformatics

• Gene Symbol: SEC24A