SEC23B Antibody


Western Blot: SEC23B Antibody [NBP2-56982] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SEC23B Antibody [NBP2-56982] - Staining of human stomach shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SEC23B Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD
Specificity of human SEC23B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEC23B Recombinant Protein Antigen (NBP2-56982PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SEC23B Antibody

  • CDA-II
  • CDAN2
  • congenital dyserythropoietic anemia, type II
  • HEMPASSec23 (S. cerevisiae) homolog B
  • protein transport protein Sec23B
  • Sec23 homolog B (S. cerevisiae)
  • SEC23-like protein B
  • SEC23-related protein B
  • transport protein SEC23B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IHC, IP
Species: Hu
Applications: WB, Simple Western, IP, ICC
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SEC23B Antibody (NBP2-56982) (0)

There are no publications for SEC23B Antibody (NBP2-56982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC23B Antibody (NBP2-56982) (0)

There are no reviews for SEC23B Antibody (NBP2-56982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC23B Antibody (NBP2-56982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SEC23B Products

Bioinformatics Tool for SEC23B Antibody (NBP2-56982)

Discover related pathways, diseases and genes to SEC23B Antibody (NBP2-56982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC23B Antibody (NBP2-56982)

Discover more about diseases related to SEC23B Antibody (NBP2-56982).

Pathways for SEC23B Antibody (NBP2-56982)

View related products by pathway.

PTMs for SEC23B Antibody (NBP2-56982)

Learn more about PTMs related to SEC23B Antibody (NBP2-56982).

Blogs on SEC23B

There are no specific blogs for SEC23B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SEC23B Antibody and receive a gift card or discount.


Gene Symbol SEC23B