SDPR Antibody


Immunocytochemistry/ Immunofluorescence: SDPR Antibody [NBP2-57218] - Staining of human cell line Hep G2 shows localization to plasma membrane & cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

SDPR Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLT
Specificity of human SDPR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SDPR Recombinant Protein Antigen (NBP2-57218PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for SDPR Antibody

  • cavin-2
  • Phosphatidylserine-binding protein
  • PS-p68
  • PS-p68serum deprivation response (phosphatidylserine-binding protein)
  • SDPR
  • SDR
  • SDRphosphatidylserine binding protein
  • serum deprivation response (phosphatidylserine binding protein)
  • serum deprivation response
  • serum deprivation-response protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for SDPR Antibody (NBP2-57218) (0)

There are no publications for SDPR Antibody (NBP2-57218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDPR Antibody (NBP2-57218) (0)

There are no reviews for SDPR Antibody (NBP2-57218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SDPR Antibody (NBP2-57218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SDPR Products

Bioinformatics Tool for SDPR Antibody (NBP2-57218)

Discover related pathways, diseases and genes to SDPR Antibody (NBP2-57218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDPR Antibody (NBP2-57218)

Discover more about diseases related to SDPR Antibody (NBP2-57218).

Pathways for SDPR Antibody (NBP2-57218)

View related products by pathway.

PTMs for SDPR Antibody (NBP2-57218)

Learn more about PTMs related to SDPR Antibody (NBP2-57218).

Blogs on SDPR

There are no specific blogs for SDPR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SDPR Antibody and receive a gift card or discount.


Gene Symbol SDPR