SDNSF/MCFD2 Antibody - BSA Free

Immunohistochemistry: SDNSF/MCFD2 Antibody [NBP2-37873] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SDNSF/MCFD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELIN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCFD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SDNSF/MCFD2 Protein (NBP2-37873PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SDNSF/MCFD2 Antibody - BSA Free

• DKFZp686G21263
• F5F8D2
• LMAN1IP
• MCFD2
• multiple coagulation factor deficiency 2
• multiple coagulation factor deficiency protein 2
• neural stem cell derived neuronal survival protein
• Neural stem cell-derived neuronal survival protein
• SDNSF
• SDNSFF5F8D

Background

The MCFD2-LMAN1 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins.Plays a role in the secretion of coagulation factors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCFD2
• Uniprot:
  • Q8NI22()