SCUBE2 Antibody

Images

 
Western Blot: SCUBE2 Antibody [NBP1-69603] - This Anti-SCUBE2 antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCUBE2 Antibody Summary

Immunogen
Synthetic peptides corresponding to SCUBE2(signal peptide, CUB domain, EGF-like 2) The peptide sequence was selected from the C terminal of SCUBE2. Peptide sequence KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCUBE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SCUBE2 and was validated on Western blot.
Theoretical MW
110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SCUBE2 Antibody

  • Cegb1
  • CEGF1
  • CEGP1
  • FLJ16792
  • FLJ35234
  • MGC133057
  • Protein CEGP1
  • signal peptide, CUB and EGF-like domain-containing protein 2
  • signal peptide, CUB domain, EGF-like 2

Background

SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77185
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF4245
Species: Hu
Applications: WB, IP
NBP2-41186
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP1-84619
Species: Hu
Applications: WB, IHC, IHC-P
AF4764
Species: Hu
Applications: WB, IHC, ICC
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-69603
Species: Hu
Applications: WB

Publications for SCUBE2 Antibody (NBP1-69603) (0)

There are no publications for SCUBE2 Antibody (NBP1-69603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCUBE2 Antibody (NBP1-69603) (0)

There are no reviews for SCUBE2 Antibody (NBP1-69603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCUBE2 Antibody (NBP1-69603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCUBE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCUBE2
Uniprot