SCGF/CLEC11a Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SCGF beta Antibody [NBP1-88076] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemistry-Paraffin: SCGF beta Antibody [NBP1-88076] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCGF/CLEC11a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCGF/CLEC11a Recombinant Protein Antigen (NBP1-88076PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCGF/CLEC11a Antibody

  • CLEC11a
  • CLECSF3
  • LSLCL
  • P47
  • SCGF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, IF, IHC, IHC-P, IP, PEP-ELISA, WB
1137-SL
Species: Hu
Applications: BA
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83139
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-41012
Species: Hu
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-52105
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
409-ML/CF
Species: Mu
Applications: BA
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88076
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SCGF/CLEC11a Antibody (NBP1-88076) (0)

There are no publications for SCGF/CLEC11a Antibody (NBP1-88076).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGF/CLEC11a Antibody (NBP1-88076) (0)

There are no reviews for SCGF/CLEC11a Antibody (NBP1-88076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCGF/CLEC11a Antibody (NBP1-88076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCGF/CLEC11a Products

Bioinformatics Tool for SCGF/CLEC11a Antibody (NBP1-88076)

Discover related pathways, diseases and genes to SCGF/CLEC11a Antibody (NBP1-88076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCGF/CLEC11a Antibody (NBP1-88076)

Discover more about diseases related to SCGF/CLEC11a Antibody (NBP1-88076).
 

Pathways for SCGF/CLEC11a Antibody (NBP1-88076)

View related products by pathway.

Blogs on SCGF/CLEC11a

There are no specific blogs for SCGF/CLEC11a, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCGF/CLEC11a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC11A