SCGF/CLEC11a Antibody - BSA Free

Staining of human cell line A-431 shows localization to centrosome.

Staining of human placenta shows moderate cytoplasmic/membranous positivity in trophoblastic cells.

Staining of human liver shows strong cytoplasmic-membranous positivity in hepatocytes.

Staining of human cerebral cortex shows strong cytoplasmic positivity in endothelial cells.

Staining of human endometrium shows strong cytoplasmic positivity in stromal cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCGF/CLEC11a Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCGF/CLEC11a Antibody - BSA Free (NBP1-88076) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC11A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SCGF/CLEC11a Recombinant Protein Antigen (NBP1-88076PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SCGF/CLEC11a Antibody - BSA Free

• CLEC11a
• CLECSF3
• LSLCL
• P47
• SCGF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC11A