SCF/c-kit Ligand Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK |
| Predicted Species |
Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KITLG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SCF/c-kit Ligand Antibody - BSA Free
Background
Mouse SCF (Stem cell factor, steel factor, Kit ligand, C-kit-ligand) is a hematopoietic growth factor that stimulates the proliferation of bone marrow stem cells. SCF induces the proliferation of mast cells and primitive lymphoid and myeloid hematopoietic bone marrow progenitor cells in culture. SCF acts synergistically with both GM-CSF and G-CSF, IL-7 and EPO. Mouse SCF is active on human cells as well as murine cells and can be used for long term bone marrow culture.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Publications for SCF/c-kit Ligand Antibody (NBP2-57463) (0)
There are no publications for SCF/c-kit Ligand Antibody (NBP2-57463).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SCF/c-kit Ligand Antibody (NBP2-57463) (0)
There are no reviews for SCF/c-kit Ligand Antibody (NBP2-57463).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SCF/c-kit Ligand Antibody (NBP2-57463) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SCF/c-kit Ligand Products
Research Areas for SCF/c-kit Ligand Antibody (NBP2-57463)
Find related products by research area.
|
Blogs on SCF/c-kit Ligand