SCF/c-kit Ligand Antibody

Images

 
Immunohistochemistry-Paraffin: SCF/c-kit Ligand Antibody [NBP2-57463] - Immunohistochemical staining of human bone marrow shows nuclear positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCF/c-kit Ligand Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Specificity
Specificity of human SCF/c-kit Ligand antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KITLG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCF/c-kit Ligand Recombinant Protein Antigen (NBP2-57463PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SCF/c-kit Ligand Antibody

  • c-kit Ligand
  • DKFZp686F2250
  • familial progressive hyperpigmentation 2
  • FPH2
  • KIT ligand
  • Kitl
  • KITLG
  • KL-1
  • Mast cell growth factor
  • MGF
  • MGFSHEP7
  • SCF
  • SCFStem cell factor
  • SFc-Kit ligand
  • SLF
  • steel factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
NBP1-80670
Species: Hu
Applications: IHC, IHC-P
NBP2-57463
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SCF/c-kit Ligand Antibody (NBP2-57463) (0)

There are no publications for SCF/c-kit Ligand Antibody (NBP2-57463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCF/c-kit Ligand Antibody (NBP2-57463) (0)

There are no reviews for SCF/c-kit Ligand Antibody (NBP2-57463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCF/c-kit Ligand Antibody (NBP2-57463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SCF/c-kit Ligand Antibody (NBP2-57463)

Discover related pathways, diseases and genes to SCF/c-kit Ligand Antibody (NBP2-57463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCF/c-kit Ligand Antibody (NBP2-57463)

Discover more about diseases related to SCF/c-kit Ligand Antibody (NBP2-57463).
 

Pathways for SCF/c-kit Ligand Antibody (NBP2-57463)

View related products by pathway.

PTMs for SCF/c-kit Ligand Antibody (NBP2-57463)

Learn more about PTMs related to SCF/c-kit Ligand Antibody (NBP2-57463).
 

Research Areas for SCF/c-kit Ligand Antibody (NBP2-57463)

Find related products by research area.

Blogs on SCF/c-kit Ligand

There are no specific blogs for SCF/c-kit Ligand, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCF/c-kit Ligand Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KITLG
Entrez