Recombinant Human SCAP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCAP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-359 of Human SCAP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SKAP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCAP2 Protein

  • Fyn-associated phosphoprotein SKAP55 homologue
  • PRAP
  • RA70Pyk2/RAFTK-associated protein
  • Retinoic acid-induced protein 70
  • SAPSSKAP55 homolog
  • SCAP2MGC33304
  • SKAP55RSKAP-55HOM
  • SKAP-HOMMGC10411
  • src family associated phosphoprotein 2
  • Src family-associated phosphoprotein 2
  • src kinase associated phosphoprotein 2
  • src kinase-associated phosphoprotein 2
  • Src kinase-associated phosphoprotein 55-related protein
  • src kinase-associated phosphoprotein of 55-related protein
  • Src-associated adapter protein with PH and SH3 domains
  • src-associated adaptor protein

Background

SCAP2( AAH02893, 1 a.a. - 360 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89076
Species: Hu
Applications: IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58023
Species: Hu
Applications: WB
AF2758
Species: Hu
Applications: WB, IHC
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20005
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF4264
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00008935-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SCAP2 Recombinant Protein (H00008935-P01) (0)

There are no publications for SCAP2 Recombinant Protein (H00008935-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAP2 Recombinant Protein (H00008935-P01) (0)

There are no reviews for SCAP2 Recombinant Protein (H00008935-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAP2 Recombinant Protein (H00008935-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCAP2 Products

Bioinformatics Tool for SCAP2 Recombinant Protein (H00008935-P01)

Discover related pathways, diseases and genes to SCAP2 Recombinant Protein (H00008935-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAP2 Recombinant Protein (H00008935-P01)

Discover more about diseases related to SCAP2 Recombinant Protein (H00008935-P01).
 

Pathways for SCAP2 Recombinant Protein (H00008935-P01)

View related products by pathway.

Blogs on SCAP2

There are no specific blogs for SCAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCAP2 Antibody
NBP2-47289
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCAP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SKAP2