SART3 Antibody

Images

 
Immunohistochemistry-Paraffin: SART3 Antibody [NBP2-13281] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SART3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYL DYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIM QNWARIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SART3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
SART3 Protein (NBP2-13281PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SART3 Antibody

  • DSAP1
  • hSART-3
  • KIAA0156squamous cell carcinoma antigen recognised by T cells 3
  • P100
  • p110
  • p110(nrb)
  • RP11-13G14
  • SART-3
  • squamous cell carcinoma antigen recognized by T cells 3
  • squamous cell carcinoma antigen recognized by T-cells 3
  • Tat-interacting protein of 110 kDa
  • Tip110
  • TIP110MGC138188

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
MAB6777
Species: Hu
Applications: WB, ICC
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SART3 Antibody (NBP2-13281) (0)

There are no publications for SART3 Antibody (NBP2-13281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SART3 Antibody (NBP2-13281) (0)

There are no reviews for SART3 Antibody (NBP2-13281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SART3 Antibody (NBP2-13281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SART3 Products

Bioinformatics Tool for SART3 Antibody (NBP2-13281)

Discover related pathways, diseases and genes to SART3 Antibody (NBP2-13281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SART3 Antibody (NBP2-13281)

Discover more about diseases related to SART3 Antibody (NBP2-13281).
 

Pathways for SART3 Antibody (NBP2-13281)

View related products by pathway.

PTMs for SART3 Antibody (NBP2-13281)

Learn more about PTMs related to SART3 Antibody (NBP2-13281).

Blogs on SART3

There are no specific blogs for SART3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SART3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SART3