SAP18 Antibody

Western Blot: SAP18 Antibody [H00010284-B01P] - Analysis of SAP18 expression in transfected 293T cell line by SAP18 polyclonal antibody. Lane 1: SAP18 transfected lysate(16.83 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SAP18 Antibody [H00010284-B01P] - Analysis of purified antibody to SAP18 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

SAP18 Antibody Summary

• Immunogen: SAP18 (NP_005861.1, 1 a.a. - 153 a.a.) full-length human protein. MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
• Specificity: SAP18 - Sin3A-associated protein, 18kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SAP18
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAP18 Antibody

• 2HOR0202cell growth inhibiting protein 38
• Cell growth-inhibiting gene 38 protein
• cell growth-inhibiting protein 38
• histone deacetlyase complex subunit SAP18
• histone deacetylase complex subunit SAP18,18 kDa Sin3-associated polypeptide
• MGC27131
• SAP18P
• Sin3A-associated protein, 18kDa
• Sin3-associated polypeptide p18
• sin3-associated polypeptide, 18 kDa
• sin3-associated polypeptide, p18

Background

Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SAP18
• Entrez:
  • 10284(Human)
• Uniprot:
  • NP_005861.1(Human)