SAMHD1 Antibody

Images

 
Western Blot: SAMHD1 Antibody [NBP2-47292] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: SAMHD1 Antibody [NBP2-47292] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SAMHD1 Antibody [NBP2-47292] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry: SAMHD1 Antibody [NBP2-47292] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: SAMHD1 Antibody [NBP2-47292] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: SAMHD1 Antibody [NBP2-47292] - Staining in human lymph node and skeletal muscle tissues using anti-SAMHD1 antibody. Corresponding SAMHD1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAMHD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVI
Specificity
Specificity of human SAMHD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAMHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
SAMHD1 Lysate (NBP2-64961)
Control Peptide
SAMHD1 Protein (NBP2-47292PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMHD1 Antibody

  • AGS5
  • CHBL2
  • DCIP
  • DCIPMg11
  • Dendritic cell-derived IFNG-induced protein
  • EC 3.1.4.-
  • HDDC1
  • Monocyte protein 5
  • MOP5
  • MOP-5
  • MOP-5AGS5
  • SAM domain and HD domain 1
  • SAM domain and HD domain-containing protein 1
  • SAMHD1
  • SBBI88

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-31363
Species: Hu
Applications: WB, ICC/IF

Publications for SAMHD1 Antibody (NBP2-47292) (0)

There are no publications for SAMHD1 Antibody (NBP2-47292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMHD1 Antibody (NBP2-47292) (0)

There are no reviews for SAMHD1 Antibody (NBP2-47292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAMHD1 Antibody (NBP2-47292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SAMHD1 Antibody (NBP2-47292)

Discover related pathways, diseases and genes to SAMHD1 Antibody (NBP2-47292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMHD1 Antibody (NBP2-47292)

Discover more about diseases related to SAMHD1 Antibody (NBP2-47292).
 

Pathways for SAMHD1 Antibody (NBP2-47292)

View related products by pathway.

PTMs for SAMHD1 Antibody (NBP2-47292)

Learn more about PTMs related to SAMHD1 Antibody (NBP2-47292).
 

Research Areas for SAMHD1 Antibody (NBP2-47292)

Find related products by research area.

Blogs on SAMHD1

There are no specific blogs for SAMHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMHD1
Entrez