SAE2 Recombinant Protein Antigen

Images

 
There are currently no images for SAE2 Protein (NBP2-34070PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAE2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBA2.

Source: E. coli

Amino Acid Sequence: DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34070.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAE2 Recombinant Protein Antigen

  • Anthracycline-associated resistance ARX
  • ARX
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ13058
  • HRIHFB2115
  • SAE2SUMO-1 activating enzyme subunit 2
  • SUMO1 activating enzyme subunit 2
  • SUMO-activating enzyme subunit 2
  • UBA2, ubiquitin-activating enzyme E1 homolog
  • Ubiquitin-like 1-activating enzyme E1B
  • ubiquitin-like modifier activating enzyme 2
  • UBLE1B

Background

Covalent attachment of one protein to another is one of the more prominent posttranslational modifications in respect to size and ubiquity. Ubiquitin is the most familiar of the protein modifiers and its activation and transfer to target proteins has been studied extensively. Recently, a new group of ubiquitin-like proteins has been receiving a lot of attention. SUMO, or Sentrin, is one of the most intriguing. SUMO has been implicated in the stabilization of target proteins and/or their localization to sub-cellular complexes. The conjugation of SUMO-1, SUMO-2 and SUMO-3 onto target proteins requires the concerted action of the specific E1-activating enzyme SAE1/SAE2, the E2-conjugating enzyme Ubc9, and an E3-like SUMO ligase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010055-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
E2-645
Species: Hu
Applications: EnzAct
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP1-84881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, In vitro, KD, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-87691
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF3444
Species: Hu
Applications: IHC, WB
NBP3-15676
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34070PEP
Species: Hu
Applications: AC

Publications for SAE2 Protein (NBP2-34070PEP) (0)

There are no publications for SAE2 Protein (NBP2-34070PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAE2 Protein (NBP2-34070PEP) (0)

There are no reviews for SAE2 Protein (NBP2-34070PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAE2 Protein (NBP2-34070PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAE2 Products

Research Areas for SAE2 Protein (NBP2-34070PEP)

Find related products by research area.

Blogs on SAE2

There are no specific blogs for SAE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAE2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA2