SAC3D1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SAC3D1 Antibody [NBP1-81664] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry: SAC3D1 Antibody [NBP1-81664] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAC3D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVE
Specificity
Specificity of human SAC3D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAC3D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SAC3D1 Protein (NBP1-81664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAC3D1 Antibody

  • SAC3 domain containing 1
  • SAC3 domain-containing protein 1
  • Sac3 homology domain 1
  • SAC3 homology domain-containing protein 1
  • SHD1HSU79266

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
AF6466
Species: Hu
Applications: WB
NBP1-87861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP2-24696
Species: Hu
Applications: IHC-P
NBP1-83393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86053
Species: Hu
Applications: IHC, IHC-P
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NBP1-81664
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SAC3D1 Antibody (NBP1-81664) (0)

There are no publications for SAC3D1 Antibody (NBP1-81664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAC3D1 Antibody (NBP1-81664) (0)

There are no reviews for SAC3D1 Antibody (NBP1-81664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SAC3D1 Antibody (NBP1-81664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SAC3D1 Antibody (NBP1-81664)

Discover related pathways, diseases and genes to SAC3D1 Antibody (NBP1-81664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAC3D1 Antibody (NBP1-81664)

Discover more about diseases related to SAC3D1 Antibody (NBP1-81664).

Blogs on SAC3D1

There are no specific blogs for SAC3D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAC3D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAC3D1