SA1 Antibody (2E9) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse SA1 Antibody (2E9) - Azide and BSA Free (H00010274-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
STAG1 (AAH64699, 1112 a.a. ~ 1221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPAPQLTSTVLRENSRPMGDQIQEPESEHGSEPDFLHNRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF |
| Specificity |
STAG1 - stromal antigen 1 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
STAG1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SA1 Antibody (2E9) - Azide and BSA Free
Background
This gene is a member of the SCC3 family and is expressed in the nucleus. It encodes a component of cohesin, a multisubunit protein complex that provides sister chromatid cohesion along the length of a chromosome from DNA replication through prophase and prometaphase, after which it is dissociated in preparation for segregation during anaphase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt, RM
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for SA1 Antibody (H00010274-M01) (0)
There are no publications for SA1 Antibody (H00010274-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SA1 Antibody (H00010274-M01) (0)
There are no reviews for SA1 Antibody (H00010274-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SA1 Antibody (H00010274-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SA1 Products
Research Areas for SA1 Antibody (H00010274-M01)
Find related products by research area.
|
Blogs on SA1