STAG2 Antibody (3C6)

Images

 
Western Blot: STAG2 Antibody (3C6) [H00010735-M01] - STAG2 monoclonal antibody (M01), clone 3C6 Analysis of STAG2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: STAG2 Antibody (3C6) [H00010735-M01] - Analysis of monoclonal antibody to STAG2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STAG2 Antibody (3C6) [H00010735-M01] - Analysis of monoclonal antibody to STAG2 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 3 ug/ml.
Western Blot: STAG2 Antibody (3C6) [H00010735-M01] - STAG2 monoclonal antibody (M01), clone 3C6. Analysis of STAG2 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: STAG2 Antibody (3C6) [H00010735-M01] - Staining of human HCT116 fixed cells. Image provided by product review by verified customer.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STAG2 Antibody (3C6) Summary

Immunogen
STAG2 (NP_006594.3, 1130 a.a. ~ 1231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF
Specificity
STAG2 - stromal antigen 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00010735-M01 in the following applications:

Publications
Read Publication using
H00010735-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAG2 Antibody (3C6)

  • bA517O1.1
  • cohesin subunit SA-2
  • DKFZp686P168
  • SA-2
  • SA2FLJ25871
  • SCC3 homolog 2
  • stromal antigen 2DKFZp781H1753

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010274-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-204
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-56651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056937-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-330
Species: Hu
Applications: ICC/IF
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
NBP1-87145
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67001
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55709
Species: Hu
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006296-D01P
Species: Hu, Mu
Applications: WB
7270-IL/CF
Species: Hu
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for STAG2 Antibody (H00010735-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for STAG2 Antibody (H00010735-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00010735-M01:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence STAG2 H00010735-M01
Enlarge
reviewed by:
Duane Compton
IF Human 05/03/2013
View

Summary

ApplicationImmunofluorescence
Sample TestedHCT116 fixed cells
SpeciesHuman
Lot12262-3c6
CommentsThe antibody works well in both IF and WB (I didn't include the western image). It binds quickly and relatively cleanly to fixed & permeabilized cells. I reuse the antibody solution often, and it does not lose signal strength. The only down side is it does not show STAG2 localization in mitotic cells (only presence or absence), but I haven't found any antibody that does.

Blocking

Blocking Details1x TBS-BSA +.1% donkey serum, 1h room-temp

Primary Anitbody

Dilution Ratio1:1000, 1h room-temp, TBS-BSA+.1%tritonX

Secondary Antibody

Secondary DescriptionAlexa Fluor 594 goat anti-mouse IgG
Secondary Manufacturer Cat#A-11032
Secondary Concentration1:2000

Details

Detection NotesNikon TE2000-E fluorescence microscope
Fixation Details3.5% paraformaldehyde 10min, TBS-BSA+.5% tritonX extraction
Wash Description1x TBS-BSA

Comments

CommentsThe antibody works well in both IF and WB (I didn't include the western image). It binds quickly and relatively cleanly to fixed & permeabilized cells. I reuse the antibody solution often, and it does not lose signal strength. The only down side is it does not show STAG2 localization in mitotic cells (only presence or absence), but I haven't found any antibody that does.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAG2 Antibody (H00010735-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STAG2 Products

Array H00010735-M01

Bioinformatics Tool for STAG2 Antibody (H00010735-M01)

Discover related pathways, diseases and genes to STAG2 Antibody (H00010735-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAG2 Antibody (H00010735-M01)

Discover more about diseases related to STAG2 Antibody (H00010735-M01).
 

Pathways for STAG2 Antibody (H00010735-M01)

View related products by pathway.

PTMs for STAG2 Antibody (H00010735-M01)

Learn more about PTMs related to STAG2 Antibody (H00010735-M01).
 

Research Areas for STAG2 Antibody (H00010735-M01)

Find related products by research area.

Blogs on STAG2

There are no specific blogs for STAG2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Duane Compton
05/03/2013
Application: IF
Species: Human

Bioinformatics

Gene Symbol STAG2
Entrez
OMIM
Uniprot