S1P1/EDG-1 Antibody


Immunocytochemistry/ Immunofluorescence: S1P1/EDG-1 Antibody [NBP2-58024] - Staining of human cell line U-251 MG shows localization to vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

S1P1/EDG-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
Specificity of human S1P1/EDG-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
S1P1/EDG-1 Recombinant Protein Antigen (NBP2-58024PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for S1P1/EDG-1 Antibody

  • CD363 antigen
  • CD363
  • CHEDG1
  • D1S3362
  • EDG1
  • EDG-1
  • EDG1edg-1
  • Endothelial differentiation G-protein coupled receptor 1
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
  • FLJ58121
  • S1P receptor 1
  • S1P receptor Edg-1
  • S1P1
  • S1P1ECGF1
  • S1PR1
  • sphingosine 1-phosphate receptor 1
  • sphingosine 1-phosphate receptor EDG1
  • Sphingosine 1-phosphate receptor Edg-1
  • sphingosine-1-phosphate receptor 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Ca, Pm, Xp
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu

Publications for S1P1/EDG-1 Antibody (NBP2-58024) (0)

There are no publications for S1P1/EDG-1 Antibody (NBP2-58024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P1/EDG-1 Antibody (NBP2-58024) (0)

There are no reviews for S1P1/EDG-1 Antibody (NBP2-58024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for S1P1/EDG-1 Antibody (NBP2-58024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for S1P1/EDG-1 Antibody (NBP2-58024)

Discover related pathways, diseases and genes to S1P1/EDG-1 Antibody (NBP2-58024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S1P1/EDG-1 Antibody (NBP2-58024)

Discover more about diseases related to S1P1/EDG-1 Antibody (NBP2-58024).

Pathways for S1P1/EDG-1 Antibody (NBP2-58024)

View related products by pathway.

PTMs for S1P1/EDG-1 Antibody (NBP2-58024)

Learn more about PTMs related to S1P1/EDG-1 Antibody (NBP2-58024).

Research Areas for S1P1/EDG-1 Antibody (NBP2-58024)

Find related products by research area.

Blogs on S1P1/EDG-1

There are no specific blogs for S1P1/EDG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our S1P1/EDG-1 Antibody and receive a gift card or discount.


Gene Symbol S1PR1