Recombinant Human S100A8 Protein

Product Discontinued

Recombinant Human S100A8 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33970 of Human S100A8 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: S100A8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: In vitro assay was reported in scientific literature.
• Theoretical MW: 35.97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S100A8 Protein

• 60B8AG
• CAGACP-10
• Calgranulin A
• calgranulin-A
• Calprotectin L1L subunit
• CFAG
• CFAGL1Ag
• CGLA
• Cystic fibrosis antigen
• Leukocyte L1 complex light chain
• MA387
• MIF
• Migration inhibitory factor-related protein 8
• MRP8
• MRP-8
• MRP8S100 calcium binding protein A8 (calgranulin A)
• NIF
• P8
• protein S100-A8
• S100 calcium binding protein A8
• S100 calcium-binding protein A8 (calgranulin A)
• S100 calcium-binding protein A8
• S100A8
• Urinary stone protein band A

Background

S100A8( AAH05928, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for S100A8 Recombinant Protein (H00006279-P01)(5)

Publications using H00006279-P01

• Shirley SH, von Maltzan K, Robbins PO, Kusewitt DF. Melanocyte and melanoma cell activation by calprotectin. J Skin Cancer. 2014-08-12 [PMID: 25197574]
• Kuwabara T, Mori K, Kasahara M et al. Predictive significance of kidney myeloid-related protein 8 expression in patients with obesity- or type 2 diabetes-associated kidney diseases. PLoS One. 2014-02-18 [PMID: 24558454]
• Maiseyeu A, Badgeley MA, Kampfrath T et al. In vivo targeting of inflammation-associated myeloid-related protein 8/14 via gadolinium immunonanoparticles. Arterioscler Thromb Vasc Biol. 2012-02-02 [PMID: 22308043] (In vitro)
• Wolf R, Howard OM, Dong HF et al. Chemotactic Activity of S100A7 (Psoriasin) Is Mediated by the Receptor for Advanced Glycation End Products and Potentiates Inflammation with Highly Homologous but Functionally Distinct S100A15. J Immunol 2008-07-15 [PMID: 18606705]
• Venkataraman N, Cole AL, Svoboda P et al. Cationic polypeptides are required for anti-HIV-1 activity of human vaginal fluid. J Immunol;175(11):7560-7. 2005-12-01 [PMID: 16301665]

FAQs for S100A8 Recombinant Protein (H00006279-P01). (Showing 1 - 2 of 2 FAQs).

1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
   • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
   • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Bioinformatics

• Gene Symbol: S100A8