Recombinant Human S100A8 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related S100A8 Peptides and Proteins

Order Details


    • Catalog Number
      H00006279-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human S100A8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33970 of Human S100A8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
S100A8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
In vitro assay was reported in scientific literature.
Theoretical MW
35.97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00006279-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S100A8 Protein

  • 60B8AG
  • CAGACP-10
  • Calgranulin A
  • calgranulin-A
  • Calprotectin L1L subunit
  • CFAG
  • CFAGL1Ag
  • CGLA
  • Cystic fibrosis antigen
  • Leukocyte L1 complex light chain
  • MA387
  • MIF
  • Migration inhibitory factor-related protein 8
  • MRP8
  • MRP-8
  • MRP8S100 calcium binding protein A8 (calgranulin A)
  • NIF
  • P8
  • protein S100-A8
  • S100 calcium binding protein A8
  • S100 calcium-binding protein A8 (calgranulin A)
  • S100 calcium-binding protein A8
  • S100A8
  • Urinary stone protein band A

Background

S100A8( AAH05928, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB
H00006279-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for S100A8 Recombinant Protein (H00006279-P01)(5)

Reviews for S100A8 Recombinant Protein (H00006279-P01) (0)

There are no reviews for S100A8 Recombinant Protein (H00006279-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A8 Recombinant Protein (H00006279-P01). (Showing 1 - 2 of 2 FAQs).

  1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
    • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
  2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
    • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Additional S100A8 Products

Research Areas for S100A8 Recombinant Protein (H00006279-P01)

Find related products by research area.

Blogs on S100A8

There are no specific blogs for S100A8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human S100A8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A8