S100A5 Recombinant Protein Antigen

Images

 
There are currently no images for S100A5 Recombinant Protein Antigen (NBP2-56319PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

S100A5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A5.

Source: E. coli

Amino Acid Sequence: KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56319.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for S100A5 Recombinant Protein Antigen

  • Protein S-100D
  • S100 calcium binding protein A5
  • S100 calcium-binding protein A5S100Dprotein S100-A5

Background

S100A5 is encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87101
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00006275-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-79899
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
NBP1-86039
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF2957
Species: Hu
Applications: IHC, KO, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
AF4874
Species: Hu
Applications: IHC, WB
NB100-56559
Species: Hu, Mu
Applications: EM, Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94448
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
262-AR
Species: Hu
Applications: BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DRG00
Species: Hu
Applications: ELISA

Publications for S100A5 Recombinant Protein Antigen (NBP2-56319PEP) (0)

There are no publications for S100A5 Recombinant Protein Antigen (NBP2-56319PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A5 Recombinant Protein Antigen (NBP2-56319PEP) (0)

There are no reviews for S100A5 Recombinant Protein Antigen (NBP2-56319PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for S100A5 Recombinant Protein Antigen (NBP2-56319PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A5 Products

Research Areas for S100A5 Recombinant Protein Antigen (NBP2-56319PEP)

Find related products by research area.

Blogs on S100A5

There are no specific blogs for S100A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our S100A5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A5