We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RUNX2/CBFA1 Recombinant Protein Antigen

Images

 
There are currently no images for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RUNX2/CBFA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNX2/CBFA1.

Source: E. coli

Amino Acid Sequence: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RUNX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52887.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RUNX2/CBFA1 Recombinant Protein Antigen

  • Acute myeloid leukemia 3 protein
  • CBFA1
  • CBF-alpha-1
  • CCD1
  • CCDAML3
  • CLCD
  • Core-binding factor subunit alpha-1
  • core-binding factor, runt domain, alpha subunit 1
  • MGC120023
  • ML3
  • oncogene AML-3
  • OSF2
  • OSF-2
  • osteoblast-specific transcription factor 2
  • PEA2aA
  • PEA2-alpha A
  • PEBP2A
  • PEBP2aA
  • PEBP2-alpha A
  • polyomavirus enhancer-binding protein 2 alpha A subunit
  • runt domain, alpha subunit 1
  • runt related transcription factor 2
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

Runt-related transcription factor 2 (RUNX2), also known as CBFA1, AML-3, PEBP-2alphaA, and OSF-2, is a transcription factor that places a critical role in osteoblast differentiation and bone development (1-3). RUNX2 is a DNA-binding protein that belongs to the RUNX family which share a common runt domain (3). RUNX2 has two main isoforms which vary based on the two promoter regions (3). The main canonical isoform (P1) has MASN/DS at its N-terminus while the other (P2) isoform includes a MRIPV pentapeptide at its N-terminus (3). The RUNX2 P1 isoform has a theoretical molecular weight of 56 kDa and is synthesized as a 521 amino acid (aa) protein containing multiple domains. Specifically, RUNX2 contains transactivation domains (AD1, 2 and 3), a glutamine/alanine (Q/A)-rich domain, a runt homology domain (RHD), a nuclear localization signal (NLS), a proline/serine/threonine (PST)-rich domain, a nuclear matrix targeting signal (NMTS), a repression domain (RD), and a VWRPY region (3). RUNX2 is a heterodimer of an alpha and beta subunit where the alpha subunit binds DNA through the runt domain and the binding affinity is increased through heterodimerization (4).

Functionally, RUNX2 promotes the expression of osteoblast-specific genes vital for the osteoblast differentiation and proliferation process including type I collagen, osteocalcin (OCN), and alkaline phosphatase (APC) (1, 3). Further evidence for the role of RUNX2 is highlighted by a study of Runx2-/-mice which completely lack osteoblasts (4). Additionally, RUNX2 is also required for chondrocyte maturation, which are the cells responsible for cartilage formation (1, 3, 5). Given the role of RUNX2 in bone and cartilage maturation and formation, it is clear that defects or mutations in RUNX2 cause various bone and bone-related diseases (3, 6, 7). For instance, cleidocranial dysplasia (CCD), which presents with delayed cranial suture closure phenotypes, hypoplastic clavicles, extra teeth, and short stature, is caused by haploinsufficiency in RUNX2 (2, 3, 6). Furthermore, metaphyseal dysplasia with maxillary hypoplasia and brachydactyly (MDMHB) is a bone dysplasia disorder with a phenotype of abnormalities in the long bones, an underdeveloped jawbone, and short fingers that is caused by a duplication in RUNX2 (6). Finally, RUNX2 has been shown to be upregulated in mouse models of the joint disorder osteoarthritis (OA) and may be a potential molecular target for disease treatment (7).

Alternative names for RUNX2 include Acute myeloid leukemia 3 protein CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, MGC120023, ML3, oncogene AML-3, OSF2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt related transcription factor 2, SL3/AKV core-binding factor alpha A subunit, and SL3-3 enhancer factor 1 alpha A subunit.

References

1. Ferreira, L. B., Gimba, E., Vinagre, J., Sobrinho-Simoes, M., & Soares, P. (2020). Molecular Aspects of Thyroid Calcification. International journal of molecular sciences. https://doi.org/10.3390/ijms21207718

2. Kim, W. J., Shin, H. L., Kim, B. S., Kim, H. J., & Ryoo, H. M. (2020). RUNX2-modifying enzymes: therapeutic targets for bone diseases. Experimental & molecular medicine. https://doi.org/10.1038/s12276-020-0471-4

3. Vimalraj, S., Arumugam, B., Miranda, P. J., & Selvamurugan, N. (2015). Runx2: Structure, function, and phosphorylation in osteoblast differentiation. International journal of biological macromolecules. https://doi.org/10.1016/j.ijbiomac.2015.04.008

4. Uniprot (Q13950)

5. Komori T. (2017). Roles of Runx2 in Skeletal Development. Advances in experimental medicine and biology. https://doi.org/10.1007/978-981-10-3233-2_6

6. Moffatt, P., Ben Amor, M., Glorieux, F. H., Roschger, P., Klaushofer, K., Schwartzentruber, J. A., Paterson, A. D., Hu, P., Marshall, C., FORGE Canada Consortium, Fahiminiya, S., Majewski, J., Beaulieu, C. L., Boycott, K. M., & Rauch, F. (2013). Metaphyseal dysplasia with maxillary hypoplasia and brachydactyly is caused by a duplication in RUNX2. American journal of human genetics. https://doi.org/10.1016/j.ajhg.2012.12.001

7. Chen, D., Kim, D. J., Shen, J., Zou, Z., & O'Keefe, R. J. (2019). Runx2 plays a central role in Osteoarthritis development. Journal of orthopaedic translation. https://doi.org/10.1016/j.jot.2019.11.008

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
4014-SP
Species: Hu
Applications: BA
DY805
Species: Hu
Applications: ELISA
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
462-TEC
Species: Mu
Applications: BA
NB100-65676
Species: Hu
Applications: ELISA, IHC, IHC-Fr,  IHC-P
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-52887PEP
Species: Hu
Applications: AC

Publications for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP) (0)

There are no publications for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP) (0)

There are no reviews for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP). (Showing 1 - 1 of 1 FAQ).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Additional RUNX2/CBFA1 Products

Research Areas for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

Find related products by research area.

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RUNX2/CBFA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2