RUNX2/CBFA1 Recombinant Protein Antigen

Images

 
There are currently no images for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RUNX2/CBFA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNX2/CBFA1.

Source: E. coli

Amino Acid Sequence: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RUNX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-52887. Protein

was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RUNX2/CBFA1 Recombinant Protein Antigen

  • Acute myeloid leukemia 3 protein
  • AML3CCD
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2A1CCD1
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB7547
Species: Hu
Applications: WB, ICC
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35216
Species: Hu
AF3075
Species: Hu
Applications: WB, ICC

Publications for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP) (0)

There are no publications for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP) (0)

There are no reviews for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP). (Showing 1 - 1 of 1 FAQ).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Additional Array Products

Bioinformatics Tool for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

Discover more about diseases related to RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).
 

Pathways for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

View related products by pathway.

PTMs for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

Learn more about PTMs related to RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP).
 

Research Areas for RUNX2/CBFA1 Recombinant Protein Antigen (NBP2-52887PEP)

Find related products by research area.

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RUNX2/CBFA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez